KEGG   Clostridium saccharolyticum WM1: Closa_3301Help
Entry
Closa_3301        CDS       T01288                                 

Definition
excisionase
Orthology
K07219  
putative molybdopterin biosynthesis protein
Organism
csh  Clostridium saccharolyticum WM1
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3548394..3549368
Genome map
AA seq 324 aa AA seqDB search
MEKIYTTQEVANQLKIKKSTVYELIKRGELKSSKVGKQIRISQEQLDEYLKAPNLGSKIQ
TEEPLPRIMDIPLFTADAAIRQMDYLLNTSGLIISSQESGVVELLRSQLSLRPDSLPILH
SYMNDYNSLYSLYYDKTHMALTSFCTSRKGQEIQQIQSLLPGKEAVILHICSLPAGLYVK
KGNPKNLHTLKDLCRPDIRFINREKGNGYRIYMDSSLSAHHIEKASISGYEKECLSHMSA
ANAVASGNTDAGIGALSHLSAYPQLDFIPLSAASMDLVFPKAAMDHPAFQSISATINSRE
FKNSLLPFKGYDIENTGNCTLIGG
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaatttataccacccaggaagttgcaaaccagcttaaaatcaaaaaatcaacg
gtatatgagctgatcaaacggggagaactaaaatcctcaaaggtcggcaagcaaataagg
atcagccaggaacagctggacgagtatttaaaggccccaaatttgggcagcaagatccag
acggaggagcctcttccccggatcatggatattcccctttttaccgccgatgccgccata
cggcaaatggattaccttcttaataccagcggcctcatcataagcagccaggaatcggga
gttgtggagctgctccgcagccagctaagtcttcgtcctgacagcctcccaatccttcat
tcctatatgaatgattataacagcctgtattccctttactacgataagactcatatggcc
cttacctctttttgcaccagccggaaagggcaggaaatccagcagatccaaagcctgctg
cctggtaaggaggccgtaatccttcacatctgcagccttccggccggcctttacgtcaaa
aagggaaatcctaaaaacctgcataccttaaaggatctgtgccgcccggatatccggttc
atcaacagagagaagggaaacgggtaccggatctacatggattccagcctttcggcccat
catattgagaaggcttccatttccggatacgaaaaggaatgcctgtcccatatgtctgct
gcaaatgcggtggcatcagggaatacagatgcaggcatcggtgctctatcccacctgtcc
gcgtatccccagctggattttattcctttgtccgccgcctccatggacctggtcttccca
aaagcagctatggatcatccggcttttcaaagcatttcagccacaattaattcccgggaa
tttaaaaacagccttcttccatttaagggatatgatattgaaaacaccggaaactgcacc
ttgatcggcggttga

DBGET integrated database retrieval system