KEGG   Clostridium saccharolyticum WM1: Closa_3581Help
Entry
Closa_3581        CDS       T01288                                 

Definition
(GenBank) class II aldolase/adducin family protein
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
csh  Clostridium saccharolyticum WM1
Pathway
csh00051  Fructose and mannose metabolism
csh01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:csh00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Closa_3581
Enzymes [BR:csh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Closa_3581
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: ADL06105
JGI: Closa_3581
UniProt: D9RAQ8
Position
complement(3879345..3879995)
Genome map
AA seq 216 aa AA seqDB search
MLLQDERKLIVEYGKRMSQEKLSPGTSGNLSIYNEEKKLMAITPSGINYMDLRPEDVVIT
DLEANIVDGSRKPSSEWALHSVFYRDKPEARAVVHSHSMYCTVLAALNLPVKAVHYVIGD
AGAAEVPCVPYHTFGTVKLAEESIKYCGNGKAVLLGNHGQIVCGSDLKSAYGLACNLEFL
AEVQYKAMCLGNPVILNDEQMKEVMEKFKTYGQANH
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgttattacaagatgaaagaaaattaattgttgaatatggaaagagaatgagccaggag
aaactttcgccgggaacaagtggtaatttaagcatttataatgaggagaaaaaattgatg
gctattacgccttccggaataaattatatggaccttcgtccggaagacgtggtgattacg
gatctggaagctaatatcgttgatggaagccgtaagccatccagcgagtgggcgcttcac
tcggttttttacagagataaaccggaagcccgcgcggtagtccattcccattccatgtat
tgtacggtcctggcggctttaaatctgcctgtaaaggcggttcattacgtcataggcgat
gccggagcggctgaagtgccatgcgtgccgtatcacacattcgggacggtgaagctggcg
gaagagtctataaagtactgtggaaacggcaaggcagtacttcttggaaatcatggacag
attgtatgcggcagtgatcttaagagcgcttatggtcttgcatgcaatctggagtttctg
gcagaagtccaatataaagcaatgtgtctgggaaaccctgtcatcttaaatgacgaacag
atgaaggaagtgatggagaagttcaagacctatggccaggcgaatcattaa

DBGET integrated database retrieval system