KEGG   Clostridium saccharolyticum WM1: Closa_3597Help
Entry
Closa_3597        CDS       T01288                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
csh  Clostridium saccharolyticum WM1
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:csh00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Closa_3597
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Closa_3597
Enzymes [BR:csh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Closa_3597
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3899580..3901136)
Genome map
AA seq 518 aa AA seqDB search
MDERGDVSMGEMTLKQKIGQMMVAGFPAGELREEMTGLVREHKVGNVILFSHNIKSRDQL
RALCDSIQRLVKEETGEYAFITIDQEGGVVRRLPEESVNIPGAMALAQTGDKKNAYEAAL
LTGQELRELGINFNLAPVLDINNNPHNPVIGVRSFGPDSTVVTEYGCEMVKGYLDSGIMC
SVKHFPGHGDTAVDSHLSLPCIGKFYEELEKEELVPFKEAFRKGVPAVTLAHILFPRIEK
ENLPVTMSETMIQGILRKKLGFQGLVISDCLEMNAIKEYFGTAFGAKKAIKAGADLIFIS
HTAGLAAEAAREIEKAVETGEIPMSRIDDAVERILAYKKRYASPHADTGKKSGKEPEQFV
KSLFRESIRFTNRERGYCHLLGDNPVFLSCYADRSTLASSRFMDDLLFAAYMQERFGGDA
YSFSIDPDPGEIGEILKKVESKGYTNLVLGTYNGHLNRGQSSLAKELEQLKIPMVMAAFR
NPYDLDEVGNGVDKIAAYEYSRQSFEAVLPLFKQCVCN
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atggatgaaaggggtgacgtgagtatgggggaaatgacattaaaacagaagatcggacag
atgatggtggcaggttttccagccggggaattaagggaagaaatgacagggctggtaaga
gagcataaagtggggaacgttattttgttttcccataatattaaaagcagggatcagctg
agggcactttgtgattccattcaaaggctggtgaaagaagaaaccggagaatatgctttt
atcaccatcgaccaggagggcggagttgtaagaagacttccggaagaatcggtcaacata
ccgggagcaatggctcttgcacagaccggagataagaaaaatgcatatgaggcggcactg
cttacggggcaggaattgagagagctggggatcaatttcaatctggctccggttctggat
attaataacaatccccataatccggtaatcggtgtacgaagctttggtccggacagcacc
gtagttaccgaatacggctgtgaaatggtgaaaggatatttagattccggaatcatgtgt
tcggtaaagcattttccgggacatggggatacggcagtggattcccatctttccctgccc
tgtatcggaaaattctatgaagaactggagaaagaggaactggttccgtttaaagaagct
ttccgtaagggggttccggcggtaactcttgctcacatattgtttccaagaattgaaaag
gaaaatttaccggtcaccatgtcagaaaccatgatccagggaatactgagaaaaaaactg
ggctttcagggactggtgatttcggattgcctggaaatgaatgccatcaaagaatatttt
ggtactgctttcggagcgaaaaaggccattaaggcaggtgctgatttgatattcatttcc
catacggcaggccttgcggcggaagcggcaagggaaatagaaaaagcagtggaaaccggc
gagattcccatgtcccggatcgacgatgccgtggagcggatccttgcatacaagaaaagg
tatgcttccccccatgcagatacgggaaaaaaatcgggaaaagaaccggagcagtttgta
aagtcgctgtttcgcgaaagcatacggtttacaaaccgggaaaggggatactgccatctg
ctgggagataatcctgtatttttaagctgttacgccgatcgttccactttggcctccagc
cgattcatggatgatctgctgtttgcagcatatatgcaggaaaggtttggaggagatgca
tactctttttccatagatcccgatcccggtgaaatcggcgaaatactgaaaaaggtagaa
agtaagggatatacgaatctggtgctcggcacctataatgggcatttaaaccgtggacag
agttcccttgctaaagaactggaacaattaaagatccccatggttatggcagcattccgg
aatccctatgatctggatgaagttggtaacggagtggataaaatagcggcatatgaatac
agcaggcaatcctttgaggcggtattgcctttgtttaagcagtgcgtctgtaattga

  All links  
No link information was found.   
DBGET integrated database retrieval system