KEGG   Clostridium saccharolyticum WM1: Closa_3623Help
Entry
Closa_3623        CDS       T01288                                 

Definition
Indole-3-glycerol phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
csh  Clostridium saccharolyticum WM1
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:csh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Closa_3623
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Closa_3623
Enzymes [BR:csh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Closa_3623
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3932130..3932924
Genome map
AA seq 264 aa AA seqDB search
MILDVLADSSRKRVEAAKEKISMKTMEKLACSALEKTKIKGLSFEQSLSSPGISFICEVK
RASPSKGLIAPEFPYVEIAKDFQAAGADAISVLTEPEYFLGNNSYLTGISHEVDLPLLRK
DFTVDPYQIYEAKVIGASAVLLICALLDPKALKEGIELCSSLGLSALVEAHDEDEIHSAL
WAGARIIGVNNRNLKTFEVDFNNSLRLRSMVPSEVLFVAESGIKTEADIRLLREAGVHGV
LIGESLMRSPDKKEIINGLKRASQ
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgatacttgatgtactggctgactcctccagaaaacgggtggaggcggcaaaagaaaaa
atctctatgaaaaccatggagaagctggcctgttccgctttggaaaaaacaaagataaaa
ggtctctcctttgagcaaagcctgtcttctccaggcatttcctttatctgtgaagtaaag
cgggcttctccttccaagggccttattgctcctgaattcccctatgtggaaatcgcaaag
gatttccaggcggctggggcggatgccatttccgtcctcacggaaccggaatactttctg
ggaaacaacagctatctgaccgggatcagccatgaagtggatctcccccttctcagaaag
gattttacagtagatccctaccagatctacgaggcaaaggtcataggcgcatcggcggtt
cttctgatctgtgccctcctggatccaaaggctctgaaagaaggaatcgagctgtgcagc
agccttggtttaagcgcccttgtggaggcccatgacgaagatgagatccattctgcccta
tgggcaggagccaggatcattggagtgaataaccggaatttaaaaacctttgaggtggat
tttaacaattccctccgtttaaggagcatggtcccctctgaagtgcttttcgtggcagaa
agcggaattaaaacagaagcagatatccggcttctgcgggaggcaggggttcatggggtt
ctgatcggggaaagcctgatgcgctccccggataagaaggaaatcataaacgggttaaag
agggcgtcccaatga

DBGET integrated database retrieval system