KEGG   Clostridium saccharolyticum WM1: Closa_3625Help
Entry
Closa_3625        CDS       T01288                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
csh  Clostridium saccharolyticum WM1
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:csh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Closa_3625
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Closa_3625
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Closa_3625
Enzymes [BR:csh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Closa_3625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
3933550..3934734
Genome map
AA seq 394 aa AA seqDB search
MSKGKFGQHGGQFVPETLMNAVNELEEAYEKYRHDQEFLAELQDLHNQYTGRPSLLYYAE
RMTKDLGGAKIYLKREDLNHTGSHKINNALGQVLLAKKMGKTRVIAETGAGQHGVATATA
AALMGMECEVFMGKEDTDRQALNVFRMELLGTKVHTVTSGTQTLKDAVNETMREWTSRVA
DTHYVLGSVMGPHPFPTIVRDFQSIIGKEVRTQLKEAEGKLPDMVIACVGGGSNAMGIFH
EFVNEPSVKLVGCEAAGHGIETGKHAATITTGSLGIFHGMKSYFCQDEYGQIAPVFSISA
GLDYPGIGPEHAALHDSGRAAYVSVTDQEAVEAFEYLSRLEGIIPAIESAHAVAYARKIA
PSMGKDSIIVINLSGRGDKDVAAIARYKGVEIYE
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaaggaaagtttggacagcacggaggacagtttgtcccggaaacgctgatgaat
gcagtcaatgagctggaagaggcttatgagaagtaccgccatgaccaggagtttctcgca
gagcttcaggaccttcacaatcaatataccggaaggccatctctgctctactatgctgaa
cgtatgacaaaggatttaggcggagcaaaaatctatttaaaaagggaggatctcaaccac
accggctcccacaaaatcaacaacgccctgggccaggtccttcttgcaaaaaaaatgggg
aagacccgggtcatcgctgaaacaggggccgggcagcacggagttgccaccgctactgct
gccgctctcatgggaatggaatgtgaggtcttcatgggaaaggaggatacggaccgtcag
gccttaaacgtattccgtatggagcttttaggtacaaaggttcacacagtaacaagcggt
acccagaccttaaaggatgcagtcaatgagactatgagggaatggaccagccgggtggct
gacacccattatgtcttaggctctgtcatgggacctcatccctttcccaccattgtaagg
gattttcagagcatcatcggcaaggaggtccgtacacagctaaaggaagcggaaggaaag
cttcctgacatggtgatcgcctgcgtgggcggaggaagcaatgccatgggaatcttccat
gagtttgtaaatgaaccttccgtaaagctggtgggctgcgaggccgcagggcacggcatt
gaaacaggaaagcacgcggctaccattaccacaggctctcttggaatcttccacggcatg
aagtcctatttctgccaggatgaatacggccagatcgcccctgtattctccatttccgca
ggacttgactatccgggcatcgggccggagcacgcagcactccatgattcgggaagagct
gcctacgtctctgttacggaccaggaggctgtggaagcctttgaatacttatcccgtctg
gaagggatcattccggccattgaaagcgcccatgcggtcgcctatgccagaaagatcgca
ccttccatgggaaaggacagtatcatagtcatcaatttatccgggcggggcgacaaggat
gtggcagccatcgcccgttacaagggggtagaaatctatgagtag

DBGET integrated database retrieval system