KEGG   Clostridium saccharolyticum WM1: Closa_3626Help
Entry
Closa_3626        CDS       T01288                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
csh  Clostridium saccharolyticum WM1
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:csh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Closa_3626
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Closa_3626
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Closa_3626
Enzymes [BR:csh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Closa_3626
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
3934727..3935500
Genome map
AA seq 257 aa AA seqDB search
MSRVSEVFSKGKAFIPFITAGDPDLSITEELVPAMAQAGADLIELGIPFSDPIAEGIVIQ
EADMRALASGVTTDKLFDSVKRIRQKTDVPLAFMTYINPVFVYGSERFIKNAAESGIDAL
IVPDMPFEEREELLPFCRKYGVELISLIAPTSKERIQAIASASEGFIYCVSSMGVTGVRT
EINTDIREMVALVKETKDIPCAIGFGISTPDQAREMSKYADGVIVGSAIVKIAAKYGKDC
VVPVCDYVREMKAAITG
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgagtagagtaagcgaagtattttcaaagggaaaggcatttatcccatttattacggca
ggggatccggacctttccatcacggaagaactggttcctgccatggcacaggccggagcg
gatctcattgagcttggaattcccttttctgatcccattgcagaggggatcgtgatccag
gaagcggatatgcgggctttggcttccggagttaccacagataaactttttgattctgta
aagcggatacgtcaaaaaaccgatgttcctctggcttttatgacttatatcaaccctgtt
ttcgtctatggaagcgagaggtttataaaaaatgcggcagaaagcggcattgatgccctg
atcgtgccggatatgccctttgaggaacgggaggaactgcttcccttctgcaggaaatac
ggggtggaactgatttccctcatagcccccacttcaaaggagcgcatacaggccattgca
tcagcatcggaaggatttatctactgtgtctcctccatgggcgtgaccggggtgagaaca
gaaatcaacacggacattagggaaatggtcgccctggtaaaggagacaaaggatattccc
tgcgccattggctttggcatctccacgccggatcaggcaagggaaatgagcaaatacgca
gacggcgttattgtgggaagtgccattgtgaaaatcgcagcaaaatatggaaaggactgt
gttgttccggtctgcgattatgttagggaaatgaaagctgccatcaccggctga

DBGET integrated database retrieval system