KEGG   Clostridium saccharolyticum WM1: Closa_3827Help
Entry
Closa_3827        CDS       T01288                                 

Definition
1-aminocyclopropane-1-carboxylate deaminase (EC:3.5.99.7)
Organism
csh  Clostridium saccharolyticum WM1
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4149144..4150118)
Genome map
AA seq 324 aa AA seqDB search
MNDVMFKTPVQEIRLSDTADRMFIKRDDLMGFSFGGNKVRIAWEFFQDMKEKGCDCLVAY
GSSRSNMCRALSNLCSRYGIPCYVLTPREDLVEEGTFNSWMVKWFGAHIRFCHKSNVAEG
VDKLMAELKSKGYRPYYIFGDRYGKGNEKAAARAYCQAYRELLEYEEDHELHFDRIFLAS
GTGMTQGGLMAGQRQYGGHARITGISVARPSCRGKSEVARFAEVDPEDVDFEDGYVCGGY
GLYDGDIESVIRMMMERFGIPLDPTYTGKAFSGMLKYLKARPHEPENILFIHTGGTPLYF
DYLNAVWDRKQAAKEITNNRCTGQ
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaacgatgtaatgtttaagactcctgtacaggagatcaggctttcggataccgccgac
aggatgtttataaagcgggatgatctgatgggtttttcctttggaggcaacaaggtccgc
attgcctgggaatttttccaggatatgaaagagaagggctgtgactgtctggtggcttat
ggaagcagccggtccaatatgtgccgcgccctgtccaacttatgcagcagatatgggatt
ccctgttacgttctcactcccagggaagatttggtggaggaagggacctttaacagctgg
atggttaagtggtttggtgctcacatccgtttctgccataaaagcaatgtggcggaaggg
gtggataagcttatggcagagctgaaatccaaaggttaccgtccctattatattttcggt
gaccgttatggaaagggaaatgaaaaggcagcagccagagcctattgtcaggcataccgg
gaattgttggaatatgaggaagatcatgagctgcattttgaccgaatctttttagccagc
gggaccggtatgacccagggcggtcttatggcagggcagaggcagtatgggggacatgcc
cgtattacagggatttccgttgcccgtccttcttgccggggaaaaagtgaagtggcccgg
tttgcagaagttgatccggaagacgtagattttgaagacggatatgtgtgcggcggctat
ggcctttatgacggagatattgagtctgtgatccgtatgatgatggaacgctttggaatc
ccgctggaccctacttatacgggaaaagcgttttccggcatgctgaaatatttaaaagcc
aggccccatgaaccggaaaacatactttttatccatacgggcgggactcccctgtatttt
gattatttaaacgcagtatgggatcggaagcaggcggcgaaggagatcaccaataaccgc
tgcaccgggcagtag

DBGET integrated database retrieval system