KEGG   Clostridium saccharolyticum WM1: Closa_3827Help
Entry
Closa_3827        CDS       T01288                                 

Definition
1-aminocyclopropane-1-carboxylate deaminase (EC:3.5.99.7)
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
csh  Clostridium saccharolyticum WM1
Pathway
Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:csh00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Closa_3827
Enzymes [BR:csh01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.15  D-cysteine desulfhydrase
     Closa_3827
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4149144..4150118)
Genome map
AA seq 324 aa AA seqDB search
MNDVMFKTPVQEIRLSDTADRMFIKRDDLMGFSFGGNKVRIAWEFFQDMKEKGCDCLVAY
GSSRSNMCRALSNLCSRYGIPCYVLTPREDLVEEGTFNSWMVKWFGAHIRFCHKSNVAEG
VDKLMAELKSKGYRPYYIFGDRYGKGNEKAAARAYCQAYRELLEYEEDHELHFDRIFLAS
GTGMTQGGLMAGQRQYGGHARITGISVARPSCRGKSEVARFAEVDPEDVDFEDGYVCGGY
GLYDGDIESVIRMMMERFGIPLDPTYTGKAFSGMLKYLKARPHEPENILFIHTGGTPLYF
DYLNAVWDRKQAAKEITNNRCTGQ
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaacgatgtaatgtttaagactcctgtacaggagatcaggctttcggataccgccgac
aggatgtttataaagcgggatgatctgatgggtttttcctttggaggcaacaaggtccgc
attgcctgggaatttttccaggatatgaaagagaagggctgtgactgtctggtggcttat
ggaagcagccggtccaatatgtgccgcgccctgtccaacttatgcagcagatatgggatt
ccctgttacgttctcactcccagggaagatttggtggaggaagggacctttaacagctgg
atggttaagtggtttggtgctcacatccgtttctgccataaaagcaatgtggcggaaggg
gtggataagcttatggcagagctgaaatccaaaggttaccgtccctattatattttcggt
gaccgttatggaaagggaaatgaaaaggcagcagccagagcctattgtcaggcataccgg
gaattgttggaatatgaggaagatcatgagctgcattttgaccgaatctttttagccagc
gggaccggtatgacccagggcggtcttatggcagggcagaggcagtatgggggacatgcc
cgtattacagggatttccgttgcccgtccttcttgccggggaaaaagtgaagtggcccgg
tttgcagaagttgatccggaagacgtagattttgaagacggatatgtgtgcggcggctat
ggcctttatgacggagatattgagtctgtgatccgtatgatgatggaacgctttggaatc
ccgctggaccctacttatacgggaaaagcgttttccggcatgctgaaatatttaaaagcc
aggccccatgaaccggaaaacatactttttatccatacgggcgggactcccctgtatttt
gattatttaaacgcagtatgggatcggaagcaggcggcgaaggagatcaccaataaccgc
tgcaccgggcagtag

DBGET integrated database retrieval system