KEGG   Clostridium saccharolyticum WM1: Closa_3882Help
Entry
Closa_3882        CDS       T01288                                 

Definition
(GenBank) 4-alpha-glucanotransferase
  KO
K00705  4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
csh  Clostridium saccharolyticum WM1
Pathway
csh00500  Starch and sucrose metabolism
csh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csh00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Closa_3882
Enzymes [BR:csh01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Closa_3882
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_77
Motif
Other DBs
NCBI-ProteinID: ADL06396
JGI: Closa_3882
UniProt: D9R0G3
Position
complement(4204424..4205902)
Genome map
AA seq 492 aa AA seqDB search
MRECGMLLPVASLPSKYGIGAFSKEAYEFIDILKKAGQQYWQILPLGPTGFGDSPYQSFS
AFAGNPYFIDLDELVKEGLLTSAECEAMDFGEDPRDIDYGKIYNNRFPLLRMAYGRWKGQ
GHKPEEPGKLLGEETSGYCFYMAVKDHFKGKSWICWDEDIRLRREDAVARYEQELSDEIG
FYGFLQIKFEEQWSRLKSYAREQGIRIIGDIPIYVAFDSADSWFHPELFQFDESREPVAV
AGCPPDGFSATGQLWGNPLYRWEYHGETGYEWWMKRMEYSFRLYDVVRVDHFRGFDEYYS
IPAGSENAVNGAWEKGPGIDIFNRMEEKFGKLDIIAEDLGFLTPSVLKLVKETGFPGMKV
LEFAFDSREESDYLPHNYTRNCVVYTGTHDNNTIRGWYQDLTAQDRQLSIDYMNNGNTPG
EEIHWDFIRLALASVARLAVIPVQDYLGLDGRARINEPSTLGKNWRWRMLSGEITEELAG
RCRKIARLYGRA
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgcgggaatgtggtatgttgctcccggttgcaagccttccgtcaaaatacgggatcggg
gcattttcaaaagaggcatatgaatttattgatatattaaaaaaagcagggcagcagtac
tggcagattctccctttaggccctaccggatttggggactctccctaccagtcattctcc
gcatttgcgggaaatccttatttcattgatctggatgagctggtgaaggaggggctgctc
acctcggcggaatgtgaggcaatggattttggagaggatcccagggacattgactatgga
aagatctacaataaccgttttcccctgttaagaatggcttacggacggtggaagggccag
ggtcataaaccggaagaaccgggaaagctccttggagaggaaacgtccgggtactgcttt
tacatggcagttaaggatcattttaaaggaaaaagctggatctgttgggatgaagacatt
cgccttcgaagggaggatgcggttgcacggtatgaacaagagctgtcagacgaaatcgga
ttttacggcttccttcagatcaagtttgaggagcagtggagcaggttaaaatcctatgcc
agggaacaaggcatccggatcattggagacattcctatttatgtggcatttgacagcgcg
gactcctggtttcatccggagctgttccagtttgatgaaagccgtgagcctgttgctgtg
gcagggtgtcctcccgatggtttttctgccaccggacagttatggggaaatcctctttac
cgctgggagtaccatggagaaacagggtatgaatggtggatgaagcggatggaatacagc
ttccgcctgtatgatgtggtgcgtgtggatcacttccgtggtttcgatgagtattattcc
attcctgccggaagtgagaatgcagtaaacggtgcctgggaaaaagggcctggaattgat
attttcaaccggatggaggaaaaattcggaaagctggatatcatagcagaagaccttggt
tttttgactccttcggttttaaaactggtaaaggaaacgggtttcccaggcatgaaggtg
ctggaatttgcctttgactccagagaagaaagtgattatctgccccataattacacccgg
aattgtgtggtatatacgggaacccatgacaacaataccatcaggggctggtatcaggat
ttaaccgcccaggaccggcagctttccattgactatatgaataacgggaacacgcctgga
gaggagatccactgggattttatccgtctggccctggccagtgtagccagactggcagtg
ataccggtccaggattatctgggccttgacgggagggcaaggatcaacgaaccttccacc
ctggggaaaaactggagatggcgtatgctttccggggaaataacagaagagcttgcagga
agatgccgaaaaattgccagactttacggcagggcgtga

DBGET integrated database retrieval system