KEGG   Clostridium saccharolyticum WM1: Closa_3888Help
Entry
Closa_3888        CDS       T01288                                 

Definition
(GenBank) 1,4-alpha-glucan branching enzyme
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
csh  Clostridium saccharolyticum WM1
Pathway
csh00500  Starch and sucrose metabolism
csh01100  Metabolic pathways
csh01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:csh00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Closa_3888
Enzymes [BR:csh01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Closa_3888
Exosome [BR:csh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Closa_3888
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_48 Alpha-amylase_C Alpha-amylase Glyco_hydro_70
Motif
Other DBs
NCBI-ProteinID: ADL06402
JGI: Closa_3888
UniProt: D9R0G9
Position
complement(4211636..4213957)
Genome map
AA seq 773 aa AA seqDB search
MDGKLYDLMDWAGIEEIVYSEAANPHNILGPHITEQGLLIQAFIPTAESVIVRFKESGKE
YPMELADEAGFFAALIPRKTAAAYILLITYDNGTSEECLDPYSYPPFYTEGDLKKFESGI
HYSIYEKMGAHPMTAGDAEGVYFSVWAPCAMRVSVVGDFNLWDGRRHQMRRLGDSGIFEL
FIPGLRAGMIYKYELKHKNGKPQLKSDPYGNYSELRPDTASVIWDINRYSWSDQEWMKKR
AGIDTKQRPMSIYEVHLGSWLRKEATLDDDGSQVVGSEFYNYRELAGKLAEYVKDMGYTH
VELLPIMEHPLDASWGYQVTGYYAPTSRYGTPDDFMYFMDYMHKQEIGVILDWVPAHFPR
DSFGLAGFDGTCVYEHKDPRQGAHPHWGTLIYNYGRPGVSNFLIANALFWVEKYHADGIR
MDAVASMLYLDYGKEPGEWIPNIYGGHENLEAVEFLKHLNSIFKSRKDGAVLIAEESTAW
PRITAGVKDDGLGFDYKWNMGWMNDFTGYMQCDPYFRKHHYGEMTFSMLYAYSEDFILVF
SHDEVVHGKGSMIGKMPGDTLEAKASNLRAAYGFMMGHPGKKLLFMGQDFAQVSEWDENK
SLDWEILAEPVHKRTKEFVKALNHLYMSQPALYQMDYDPEGFEWVECTDSKDSITGFLRK
TKKKEETLLILCNFDTVLHEKYPVGVPFEGKYKEILNSDHQAFGGEGRVNPRVKTSKKKE
ADERPDSIEITLAPLSVLVFACTPEKKSALIAGKKAGKSAYKKKAKGESKDQA
NT seq 2322 nt NT seq  +upstreamnt  +downstreamnt
atggatggaaaattgtatgatttaatggattgggccggcattgaggaaattgtatattca
gaagcagcgaatccccacaacattctgggaccccatatcacagagcagggactgcttatc
caggcatttattcctacggcagaatcggtgattgtccggtttaaggaaagcggtaaggaa
taccctatggagcttgcggatgaagctggattttttgcggctctcataccgaggaaaaca
gcagcagcctatattctgctgatcacttatgacaatgggacgtcagaggaatgtctggat
ccctattcctatccacccttctacacagaaggagatcttaaaaagtttgaatccggaatt
cactacagtatctacgaaaaaatgggggcgcaccctatgactgccggcgatgcggaaggg
gtatatttttccgtgtgggcaccatgtgccatgcgtgtcagcgtggtaggggattttaac
ctgtgggatggcaggcgtcaccagatgaggaggctgggggattccggtatttttgaattg
tttattcccggcttaagggcagggatgatttataagtatgagctgaagcataaaaacggg
aagcctcagctaaaaagtgatccttatggcaattacagcgagctgcgacctgatactgct
tccgtgatctgggacattaaccggtattcatggagtgaccaggaatggatgaaaaaacgg
gcaggaattgataccaagcaaaggcctatgtccatttatgaggttcacttaggctcctgg
cttcggaaggaagcaacgcttgatgatgacggtagccaggtcgttggctctgaattctat
aattaccgtgagttggcaggaaagctggcggaatacgtgaaggatatgggctacacccat
gtggagctccttcccattatggagcatcccctggatgcttcctggggatatcaggtgacc
ggttattatgcacctaccagccgctatggaacgcctgatgattttatgtattttatggat
tacatgcataagcaggaaatcggcgtaatcttagactgggttccggctcatttccccaga
gacagctttggactggcgggctttgacgggacctgcgtttatgagcataaagacccaaga
cagggagcccatcctcattggggcactttgatttataattacggcagaccgggagtcagc
aattttctcattgccaatgccctgttttgggtggaaaagtatcatgccgacggaatccgc
atggatgcggtggcttccatgctgtatttggattacggaaaagaacctggagaatggatt
cccaatatttacggcggtcatgagaacctggaagccgtggagttcttaaagcacttaaac
tccatatttaagagcagaaaggacggggcggttctcattgcggaggaatctacggcatgg
cccaggatcacggctggtgttaaggacgatggccttggttttgattataaatggaacatg
ggctggatgaatgactttaccggctacatgcagtgcgacccttattttcgcaagcatcac
tatggagagatgaccttcagcatgctttacgcttacagtgaagatttcattcttgtattc
tcccatgacgaggtggttcatgggaaaggctccatgatcggcaaaatgccgggggatacc
ctggaagcaaaggcgtccaatttacgggcggcctatggcttcatgatggggcatcccggt
aaaaagcttctgttcatgggacaggattttgctcaggtcagcgaatgggatgaaaacaaa
agccttgactgggagatccttgccgaaccggttcataaacggacaaaggaattcgtaaag
gccttaaaccatctgtatatgagccagccggccctgtatcagatggattatgatccggag
ggatttgaatgggtggagtgtacggattccaaggacagtatcacaggctttttaagaaaa
acaaagaaaaaggaagaaacccttctcatcctctgtaacttcgatactgtgctccatgag
aaatacccggtaggagttccctttgaaggaaagtataaggaaatcttaaacagcgaccat
caggccttcggcggggagggccgcgtgaatccccgggtaaagacttctaagaaaaaagag
gcggacgaaaggcctgattccatagaaatcacccttgcccccttaagcgttttagtcttt
gcctgtacccctgagaaaaagagcgccttaatcgcagggaaaaaggccggaaagtctgca
tataagaaaaaagcgaaaggcgaaagtaaagatcaggcgtaa

DBGET integrated database retrieval system