KEGG   Clostridium saccharolyticum WM1: Closa_4007Help
Entry
Closa_4007        CDS       T01288                                 

Definition
acetaldehyde dehydrogenase
Orthology
K00132  
acetaldehyde dehydrogenase (acetylating) [EC:1.2.1.10]
Organism
csh  Clostridium saccharolyticum WM1
Pathway
Pyruvate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:csh00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Closa_4007
   00650 Butanoate metabolism
    Closa_4007
Enzymes [BR:csh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Closa_4007
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4345947..4347494)
Genome map
AA seq 515 aa AA seqDB search
MENFDYDLRSIQEARDLARCGEAAAKKIAGYTAEQIDTILKSMAKAGEEHALCLAEMAVE
ETGFGKAMDKAYKNHAASTLLYEEIKNMKTRGILEEDTVNKTIDVAEPVGLVMGIVPSTN
PTSTVFFKSMIAIKSGNAIVFSPHPSAAKCTLKAAEVMRDAAMAAGAPEGIIGCVTMPSM
GSTNELMKCKEVSVIIATGGPGMVKAAYSAGKPAIGVGAGNSPAYIEKTADVKQAVKTIL
ASKTFDYGTICASEQSIICEESNHAEVVAELKSQGGYFMSKEETDKVCDLLFKNGHNMNA
KFVGRSPQVIAQAAGIQIPEGTKVLIGKQEGVGEGYPLSYEKLTTVLGFYTVKNWEEACG
LSIRLLQNGIGHTMSIHTQDRDMVLKFAAKPASRILVNTGGSQGGTGISTGLPISFTLGC
GTCGGSSVSENVSPKHLLNVKKVAFGLKDCSAIAEEDPAFLWKEKSQGASLSPAEFAASF
DKKEGSPAASVLGGCDDNEKLAALVKEIILAMKSQ
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atggaaaattttgattatgatttgcgttccatccaggaagcaagggatttagcaagatgc
ggcgaagcagccgcaaaaaagattgccggatatacggcagaacagattgacaccattctt
aaaagcatggcaaaggcaggagaagaacacgctctttgcctggcggaaatggctgtggaa
gagaccggttttggaaaggctatggacaaggcatataagaatcacgccgcctccactctt
ttatatgaagaaatcaagaatatgaagacaagagggattcttgaggaggatacggtgaat
aaaaccattgatgtggcagagccggtcggacttgttatgggaatcgttccctccaccaac
cccacctccaccgtattttttaaatccatgattgccattaaatccggaaatgccattgtc
ttttcgcctcatccttctgctgcaaaatgcaccttaaaggcggcagaggtcatgcgtgac
gccgcaatggcagcaggcgcaccggaggggatcatcggctgtgtaaccatgccatccatg
ggctctaccaacgagctgatgaagtgcaaggaggtttccgttatcattgcaaccggaggt
ccgggcatggtgaaagcggcatacagtgctggaaagccggccattggcgtaggtgcagga
aactccccggcttacatagaaaaaacggctgatgtaaagcaggcggtaaagacaatcctt
gcaagcaagacctttgactatggtaccatctgtgcatccgagcagtccatcatctgcgag
gaaagcaaccacgcagaagtggtggcggagttgaaaagccagggcggttactttatgtca
aaggaagaaacagacaaagtatgcgatctgttatttaaaaacggccataacatgaatgcc
aaatttgtgggccgctctccccaggtgattgcacaggcagcaggcatccagatcccggag
ggaaccaaagtccttatcggcaagcaggagggcgttggagaaggatatccgttatcctat
gaaaagctgacaactgttcttggtttttacaccgtaaagaactgggaagaggcctgcggc
ttaagcatccgtctgttacagaatggaatcgggcataccatgagcattcatacccaggac
agggatatggttcttaaatttgcggcaaagccggcttccaggatccttgtaaacaccgga
ggaagccagggcggaaccggaatcagcacaggccttcccatttcctttacattaggctgc
ggaacctgcggcggcagctctgtttctgaaaacgtaagcccgaagcatctcctcaatgtg
aaaaaggtagcttttggcttaaaggattgttccgccattgcagaagaggatcctgccttt
ctatggaaggaaaaatcccagggcgcatccttaagccctgctgaatttgccgcttccttt
gataaaaaagaaggttctccggcggcttccgttctgggaggctgtgatgacaatgagaag
ctggctgctcttgttaaggagatcatactggctatgaaaagtcagtaa

DBGET integrated database retrieval system