KEGG   Clostridium saccharolyticum WM1: Closa_4104Help
Entry
Closa_4104        CDS       T01288                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
csh  Clostridium saccharolyticum WM1
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:csh00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4440358..4441857)
Genome map
AA seq 499 aa AA seqDB search
MGRYVIALDQGTTSSRCILFDEQGNICSAAQKEFTQIFPQPGWVEHDPMEIWSSQLSVTM
EAMGKIGAHYSDIAAIGITNQRETTVVWDKETGEPVYHAIVWQCRRTSDRIEKLKQDGLE
EMVIDRTGLIPDAYFSGSKIEWILDNVKGARERAERGELLFGTVDTWLIWNLTKGCIHVT
DYTNASRTMLFDIHRKCWDEEILNYFRIPKCMLPEVKPSSCIYGYTSSDVMGGKIPIAGA
AGDQQAALFGQCCFEAGEVKNTYGTGCFLLMNTGEKAVKSGHGLLTTIAASDQGSIQYAL
EGSVFVAGAAVQWLRDEMRMVRSASQTEEYCKAVEDTGGVYIVPAFAGLGGPYWDQYARG
TIVGVTRGTSKEQFIRATVESMAYQVYDLIEAMEQDSDIHLKQLKVDGGACANNFLMQFQ
SDLLNTELVRPECIETTALGAAYLAGLAVGYWKNREEIKANWKASRSFGSQMEEEYRKKL
VKGWKRAVKCALCWSEDEK
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgggaagatatgtcattgccctggatcagggcacgacaagttccaggtgcatcctgttc
gatgaacagggaaacatctgcagtgcagcacaaaaggagtttactcagatttttccgcag
cctgggtgggtggagcatgaccccatggagatatggtcttcacagctgtctgtgaccatg
gaggccatgggaaagatcggggcccattacagtgacattgctgccatcgggatcaccaac
caaagggaaactacggtggtctgggataaagagacaggggagccggtttaccacgccatc
gtatggcaatgccgcaggacttccgacaggatcgaaaaactgaagcaggatgggctggaa
gaaatggtgattgacaggacaggactcatccccgatgcctatttttcaggaagcaagatc
gaatggatcctggataatgtaaaaggggcaagagaacgggcagaacggggggagttgctg
tttggaacggtggatacctggctgatctggaacttaaccaagggctgtatccatgtaacg
gattataccaatgcttccaggaccatgctttttgacattcacaggaaatgctgggatgaa
gagatccttaactatttcaggatcccgaagtgcatgctgccggaagtgaaaccctcaagc
tgtatatacggctacacctcatccgatgtaatgggaggaaagatccctattgcaggagca
gcaggagaccagcaggcggcgttattcggccagtgctgctttgaagcgggagaggtgaag
aacacctatggaaccggctgtttccttcttatgaatacaggagaaaaggcggtgaagtcc
gggcacgggctgctgactaccatagcagccagcgatcagggaagcatccagtatgccctg
gaagggagcgtatttgtggcgggcgctgctgtacagtggttaagggatgagatgcggatg
gtccgttccgcctcccagacggaggaatactgcaaggctgtggaagataccgggggtgtt
tacatagtaccggcctttgctgggcttgggggcccttattgggaccagtatgcaagggga
accattgtaggggtgacaagggggaccagcaaggagcagtttatcagggccacggtggaa
tccatggcttatcaggtttacgatcttattgaagccatggagcaggattcggatatccat
ttaaagcagttaaaggtggatgggggcgcatgtgccaacaattttcttatgcagttccag
tctgacttgctgaatacggagcttgtaagaccggaatgcattgaaaccacggccctggga
gccgcatacttagccgggcttgcggtgggctactggaaaaaccgggaagagatcaaggcc
aactggaaggcatccaggtcctttggcagccagatggaggaagaataccggaaaaagctg
gtaaagggctggaagagagcggtaaaatgtgccctttgctggtcggaagacgagaagtag

DBGET integrated database retrieval system