KEGG   Clostridium saccharolyticum WM1: Closa_4287Help
Entry
Closa_4287        CDS       T01288                                 

Definition
iron-containing alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
csh  Clostridium saccharolyticum WM1
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:csh00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Closa_4287
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Closa_4287
   00620 Pyruvate metabolism
    Closa_4287
   00650 Butanoate metabolism
    Closa_4287
  Lipid metabolism
   00071 Fatty acid degradation
    Closa_4287
  Amino acid metabolism
   00350 Tyrosine metabolism
    Closa_4287
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Closa_4287
   00626 Naphthalene degradation
    Closa_4287
Enzymes [BR:csh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Closa_4287
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Closa_4287
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4645929..4648544)
Genome map
AA seq 871 aa AA seqDB search
MAKKEEQVKVPQIIDNVDALIAKMEAMREAQRVFATFTQEQVDKIFYEAASAANKLRIPL
AKMAVQETGMGVVEDKVIKNNYAAEYIYNTFKDTKTCGVIEEDKAYGIKKIAEPIGLVAA
VIPTTNPTSTAIFKTLISLKTRNAIMISPHPRAKNSTIAAAKVVLDAAVKAGAPEGIIGW
IDVPSLELTNEVMRSADIILATGGPGMVKAAYSSGKPALGVGAGNTPVIIDDTADIKMAV
SSIIHSKTFDNGMICASEQSVTVLESIYDAVKKEFGARGCYFLKGNEIDKVRKTIIINGA
LNAKIVGQKAATIAKLAGVEVPEDTKILIGEVESVHIEEEFAHEKLSPVLAMYKAKTFDE
AIEKAEQLVADGGYGHTSSLYVNVNEKEKMEKHAAAMKTCRILVNTPSSHGGIGDIYNFK
LQPSLTLGCGSWGGNSVSENVGVKHLLNIKTVAERRENMLWFRNPEKVYFKKGCMPVALS
ELKDVYNKKRAFVVTDSFLYMNGYTKPITDKLDEMGIVYTVFSDVQPDPTLANAQAGAAA
MKAFQPDTIIALGGGSAMDAAKIMWVMYEHPEVDFQDMAMRFMDIRKRVYTFPKMGEKAY
FVAIPTSSGTGSEVTSFAVITDQETGVKYPLADYELMPDMAIVDADNMMSQPRGLTSASG
IDVMTHALEAYASVMASDYTDGLALKAMKNVFDYLPTAYKDGTNVEARCKMADASCMAGM
AFNNAFLGVCHSMAHKLGAYHHLPHGVANALLITLVMEFNACEVPAKMGTFPQYEYPHTL
ARYAECARFCGLEGKDDAELLKKLIAKIEELKKAVGIKSSIKEYGIDEKNFLDTLDEMVE
NAFDDQCTGANPRYPLMSEIKEMYLKAYYGK
NT seq 2616 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagaaagaagaacaggtaaaggttccccagatcatagataatgtagatgcattg
atcgccaagatggaagctatgagggaagcccagagagtatttgctaccttcactcaggag
caggtagataagattttttatgaagcagcaagtgctgccaataaactgagaattcctctg
gcaaaaatggctgtccaggaaaccggcatgggcgtagtggaggacaaggttattaagaac
aactatgcggctgaatatatttataatacatttaaggatactaaaacttgcggtgtgatt
gaagaagataaggcatacggtattaagaagattgcagagcccattggtctggttgcggcg
gtaattccaaccaccaatcccacatcaacggctattttcaaaactcttatcagcttaaag
accagaaacgccattatgatctccccccatccccgtgcaaagaattccacgattgcggct
gcaaaagtagttctcgatgctgcagttaaagcaggtgcacctgagggaatcattggctgg
attgatgtaccgtccctggaactgaccaatgaggtcatgagaagtgcggatattatcctg
gcgaccggaggccctggaatggtaaaggccgcttattcttccggtaaacctgctcttggt
gttggtgcaggtaatacccctgtcattattgatgatacggcggatataaagatggctgtc
agctcgatcattcattccaagacctttgataatggtatgatctgcgcttctgagcagtct
gtgacagtacttgaaagtatttatgatgcggttaaaaaagaattcggagccagaggttgt
tatttcttaaagggcaatgagattgataaggttcgtaagaccattatcatcaatggcgcc
ttaaacgccaagatcgtagggcagaaggccgcaaccattgcaaagcttgcaggggttgaa
gtaccggaagacacaaaaatcctgatcggtgaggttgagagcgttcatattgaagaagaa
tttgcacatgaaaagctgtctccggtgctggcaatgtataaggcaaagacatttgatgag
gccattgagaaggcagaacagctggttgctgacggcggttacggacatacctcttctctc
tatgtaaatgtaaatgaaaaagaaaaaatggagaagcacgcagcggctatgaaaacctgc
cgtattctggtgaacactccttcttcccacggcggcatcggtgatatttataacttcaag
cttcagccatccctgaccttaggctgcggttcctggggcggaaactctgtttctgaaaac
gttggggtaaagcatttgctgaatattaagaccgttgctgagaggagagagaacatgctg
tggttcagaaatccggaaaaggtttactttaaaaaaggatgtatgcctgtcgcacttagc
gaattaaaggatgtctataataaaaagagagcattcgtagtaactgactccttcctttac
atgaatggctatacaaaaccgattacagataaattagatgaaatgggcatcgtttatacc
gtattttccgatgttcagcctgatccgaccctggcaaatgcccaggcaggcgcggcagcc
atgaaggcattccagccggataccattatcgcattgggaggcggttctgccatggacgca
gccaagatcatgtgggttatgtatgaacatccggaggtggatttccaggatatggcgatg
cgttttatggatatccgtaagagagtctacacattcccaaaaatgggagaaaaagcttac
tttgtggccatccccacatcttccggtaccggctctgaggtaacttccttcgcggttatt
actgaccaggaaacaggagtgaaatatcctcttgcagattatgaattaatgccggatatg
gcgattgttgatgcagacaatatgatgagccagcccagaggtcttacaagcgcttccggt
atcgacgttatgactcatgcattggaggcttatgcatctgtaatggcttccgattatacg
gatggccttgcactgaaggcaatgaaaaatgtatttgactacctgcccacagcatacaag
gacggaaccaacgtagaagcgagatgtaagatggcagatgcttcctgcatggcaggtatg
gcatttaacaatgcattcttaggtgtatgccattccatggctcataaattaggtgcttac
catcaccttcctcatggtgttgcaaatgccttgctgatcaccttggtcatggagttcaat
gcttgtgaagttccggctaaaatgggaaccttcccacagtatgagtatcctcataccctt
gcaagatatgctgagtgtgcacgcttctgcggcttagaaggcaaggatgatgccgaactg
cttaagaaactcattgcaaagattgaagaattaaagaaggcagtggggatcaaatcaagc
attaaggaatatggcattgatgaaaagaacttcctggatactttggatgaaatggttgaa
aatgcatttgatgaccagtgtacaggagcaaacccaagatatcctctcatgagtgagatc
aaggaaatgtatttaaaagcttattacggtaaataa

DBGET integrated database retrieval system