KEGG   Cronobacter sakazakii CMCC 45402: P262_01305Help
Entry
P262_01305        CDS       T02955                                 

Definition
hypothetical protein
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
csi  Cronobacter sakazakii CMCC 45402
Brite
Enzymes [BR:csi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     P262_01305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
961048..961530
Genome map
AA seq 160 aa AA seqDB search
MGAVLALATLLPDYGRLHTSPQGLALIGDLEGCRLKPYQCSAGVWTSGIGHTAGVVPTRD
ITEREAAVNLVGDVLKVEKALAVCAPVAIPQPVYDAVVSFSFNVGTGAACRSTLVSYLKR
HQWWQACNELSRWVYVNGVRNAGLENRRTRERALCLKGAL
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
gtgggcgccgtgctggcgctggccacgctgctgcccgattacgggcgtctgcatacctcg
ccgcaggggctcgcgctgattggcgatctggaggggtgccgcctcaagccctaccagtgc
agcgccggcgtctggacgtcgggcatcggtcacacggcgggggtggtgccgacgcgtgat
atcaccgaacgcgaggccgccgtgaacctggtcggcgacgtgctgaaggtggagaaagcg
ctcgcggtctgcgcgccggtcgccataccgcagccggtttatgacgcggtggtcagtttt
tcttttaacgtcggcaccggggcggcctgccggtcaacgctggtttcctatctcaagcgc
catcagtggtggcaggcgtgtaacgagctgtcgcgctgggtgtatgtcaacggtgtgcgc
aacgccgggcttgaaaaccgccgcacccgtgagcgggcgctgtgcctgaaaggagcacta
tga

DBGET integrated database retrieval system