KEGG   Cronobacter sakazakii CMCC 45402: P262_02097Help
Entry
P262_02097        CDS       T02955                                 

Definition
gabT protein
Orthology
K07250  
4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
csi  Cronobacter sakazakii CMCC 45402
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:csi00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:csi00650]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:csi00250]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:csi00280]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:csi00410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1553925..1555223
Genome map
AA seq 432 aa AA seqDB search
MMQSNQQWQERREQAVPQGVGNALPVFVARAKNAEIWDVEGRRYIDFASGIAVLNTGHNH
PAVIAAVKAQLDNFTHPCFQVTPYGNYIELAERLNRLAPISEPCQTLFLSTGAEAVENAI
KVARIATGRSAVIAFRGAFHGRTLLGMALTGKVQPYKKGYGPFPAGIYHAPYPAAYLGVS
DTQALASLAGIFAADVAPEEVAAIIIEPVQGEGGFYAASAEFMQQLRALCDKHGIVLIVD
EIQSGFCRTGKTFAIEHSGVEPDLITMAKSLAGGFPLSGLVGKKALFDKALPGGLGGTYA
GSPVSIAAALAVTDLIEEEQLNARAIAQGELLMSRLRELAQEYDFIGDVRGVGAMVAMEL
VHERDSHRPDKELTQQLVQEAGRQGLILLTCGVRANVIRFLIPLTAEKEIVTEGLNILSS
CLKVVQNTRPAK
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgatgcaaagcaatcagcagtggcaggagagacgcgagcaggcggtgccgcagggcgtg
ggtaacgcgctgccggtatttgtggcgcgggctaagaacgcggaaatctgggatgtggag
gggcggcgctatatcgatttcgcctccggcattgcggtgctcaataccgggcacaatcac
ccggcggttatcgcggcggtgaaggcgcagctcgataattttacgcatccctgttttcag
gtcacgccttacggcaattacattgagctcgcggaacgcctgaaccggctggctcccatc
agcgaaccctgccagacgctgtttctctcaaccggcgccgaggccgtggaaaacgccatt
aaagtggcgcgtatcgccacggggcgctcggcggtgattgcgtttcgcggcgcgtttcat
ggccgtacgctgcttggcatggcgctcaccggcaaagtgcagccgtataaaaaaggctat
ggcccgttcccggcggggatttaccacgcgccttacccggcggcgtatctgggcgtgagc
gacacgcaggcgctggcgtcgctggcggggattttcgccgcagatgtggcacccgaagag
gtggcggcgatcattatcgagccggtgcagggcgagggcgggttttacgccgcctctgcc
gagtttatgcagcagttgcgtgcactgtgcgataaacatggcatcgtgctgattgtcgat
gagatccagagcggcttctgccgtaccggaaaaaccttcgccatcgaacattcaggtgtt
gagccggatctcattaccatggccaaaagcctggcgggcgggttcccactctcggggctg
gtgggtaaaaaggcgctgtttgataaagccctgccgggcgggcttggcggcacgtatgcc
gggtcgccggtgagtatcgccgcggcgctggcggtgaccgatctcatcgaagaggagcaa
ttaaacgcacgcgccatcgcgcagggcgagctgctgatgagccgcctgcgcgaactggcg
caggagtatgactttatcggcgatgtgcgcggcgtcggcgcgatggtggcgatggagctg
gtgcatgagcgcgacagccatcgcccggacaaagaattgacccagcaactggtgcaggag
gcagggcgtcaggggctgattttactgacctgcggcgtgcgtgcgaacgtcatccgtttc
cttatcccgctcaccgctgagaaagaaattgtgacagaaggtctcaacatcttgtcatcc
tgccttaaagtggtgcaaaatacgcgccctgcaaaataa

DBGET integrated database retrieval system