KEGG   Cronobacter sakazakii CMCC 45402: P262_02890Help
Entry
P262_02890        CDS       T02955                                 

Definition
(GenBank) hypothetical protein
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
csi  Cronobacter sakazakii CMCC 45402
Pathway
csi00220  Arginine biosynthesis
csi00250  Alanine, aspartate and glutamate metabolism
csi00471  D-Glutamine and D-glutamate metabolism
csi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csi00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    P262_02890
   00220 Arginine biosynthesis
    P262_02890
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    P262_02890
Enzymes [BR:csi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     P262_02890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase CCD
Motif
Other DBs
NCBI-ProteinID: AHB70424
UniProt: V5U0S7
Position
2122784..2123710
Genome map
AA seq 308 aa AA seqDB search
MIHTLNNDLLASILEQVRPLAAQGKVADYIPALADVPADRLGIAVCTVGGECFAAGDADE
RFSIQSISKVLSLVLAMGRYDDDEIWQRVGKDPSGQPFNSLVQLELEQGKPRNPFINAGA
LVVCDMLQSRLSAPKQRMLEVVRNLCGAPDIIYDTAVARSEFEHSARNAAIAYLMKSFGN
FHNDVITVLQNYFHYCALKMSCAELARAFLFLANQGRAPHLDTPVISPVQARQVNALMAT
SGMYESSGEFAWRVGMPGKSGVGGGIIAVVPHEMSIAVWSPALDHAGNSLAGIAALEILA
REIGRSIF
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
gtgatccacacgcttaataacgatttactggcttcaattctcgaacaggtgcgcccgctc
gccgcacagggcaaggtggcggactatattccggcgctggcggatgtacccgccgaccgg
cttggcatcgccgtctgtacggtcggcggcgaatgttttgccgcaggcgacgccgatgag
cgcttctccattcagtccatttcaaaagtgctgagcctggtgctggcaatggggcgctac
gacgacgacgagatctggcagcgcgtcgggaaagatccctccggccagccgttcaactcg
ctggtgcagctggagctggagcagggcaaaccgcgtaacccgtttatcaacgcgggcgcg
ctggtggtctgcgatatgctgcaaagccgcctgagcgccccgaaacagcggatgctggaa
gtggtgcgtaatctctgcggcgcgccggatatcatctatgacaccgccgtggcgcgctct
gagtttgaacactcggcccgcaacgccgccatcgcgtatctgatgaaatccttcggcaat
ttccataacgacgtcatcaccgtgttgcagaactatttccattactgcgcgctgaagatg
agctgcgcggagctggcgcgcgcctttctgtttctggcgaatcagggaagggcgccgcat
ctggatacaccggtaatcagcccggtgcaggcgcgtcaggttaacgcactgatggcgaca
agcggcatgtatgaaagctccggcgaattcgcctggcgcgtggggatgccggggaaatcg
ggcgtcggcggcggtataatcgccgtagtgccgcatgagatgtctatcgcggtctggagc
ccggcgctcgatcacgccggtaactcgctcgccggtatcgcggcgctggaaattctcgcc
cgtgaaattggccgttccattttctga

DBGET integrated database retrieval system