KEGG   Cronobacter sakazakii CMCC 45402: P262_03891Help
Entry
P262_03891        CDS       T02955                                 

Definition
pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
csi  Cronobacter sakazakii CMCC 45402
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    P262_03891
   00500 Starch and sucrose metabolism
    P262_03891
Enzymes [BR:csi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     P262_03891
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2908710..2910020
Genome map
AA seq 436 aa AA seqDB search
MNTFSVSRLALAFAFGVTLTACSSTPPDQRPSEQRAPGTSARPVLSADEAKNFVPARYFS
NVDPNAAPWAPSPIRLPEKADFVVGQAGEQGVTHTSIQAAVDAAIARHATARQYIAVLPG
TYEGTVYVPAAPGSVTIYGTGEKPLDVKISAALDSEMDANTWRRTVNPSGKYMPGKPAWY
MFDNCQNRRNGTVGLMCSAVFWSQNNGLQLQNLTIENSLGDAAGEGQHQGVALRTDGDRV
QINKVNVLGRQNPFLVTNSDIRNRFTPDRLTRTQVTNSYVEGDVDLVAGRSAVVFDNTEF
RVVNTRTQKEGYVFAPATMPNFYYGFLAVNSRFVAAGEGVAQLGRAWDMDASANGYTPGQ
TPNGQVVIRDSVIDAGFNTAQPWGTALGSQRPFTGNTGAQDDKGNIQRDLNDANANRLWE
YNNRGLGSKVVAEPKK
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
ttgaacacattttcggtttcccgtctggcgctggcgttcgcttttggcgtgacactgact
gcatgcagctcaacgccaccggaccaacgtccttctgaacaacgcgcgccgggtacgtcg
gctcgcccggtgctgtctgcggatgaagcgaaaaatttcgtcccggcccgctatttctcc
aatgtcgatccgaatgccgcgccgtgggcgccctccccgattcgactgcctgaaaaagcg
gactttgtggtcggccaggcgggcgagcagggcgtgacccacaccagcattcaggcggcc
gttgacgccgctattgcgcgccacgcgacggcacgtcagtacatcgctgtgctccccggc
acctatgaaggcaccgtttacgtgcctgcggcaccgggcagcgtgacgatttacggcacc
ggcgaaaaaccgctggatgtgaaaatcagcgccgcgctggacagcgaaatggatgccaac
acctggcgtcgtaccgtgaacccgtccggcaaatatatgcccggcaaaccggcctggtat
atgttcgataactgccagaaccgccgcaacggcaccgtcggcctgatgtgttccgcggtg
ttctggtcgcagaataatggcctgcaactgcaaaacctgaccatcgaaaacagcctcggc
gacgccgcaggcgaaggtcagcaccagggtgtcgcgctgcgtaccgatggcgaccgcgtg
cagatcaacaaagtgaatgtcctgggccgccagaatccgttcctggtgaccaacagcgat
atccgcaaccgcttcacgccggatcgtctgacccgcacgcaggtgacgaacagctacgtg
gaaggcgatgtggatctggtcgcgggccgcagcgcggtagtgtttgataacaccgaattc
cgcgtggtgaacacacgtacccagaaagaaggttatgtgtttgcgccagcgaccatgccg
aacttctattacggcttcctcgccgtgaacagccgctttgtggcggcaggtgaaggcgtg
gcgcagcttggccgcgcatgggatatggacgcgagcgccaatggttataccccaggccag
acgccgaacggtcaggtggttatccgcgacagcgtgattgacgccggtttcaacaccgcg
cagccgtggggcaccgcgctcggttcacagcgtccgttcaccggcaacaccggcgcgcag
gacgataaaggcaatatccagcgcgatctgaacgatgcgaacgccaaccgtctgtgggaa
tacaacaaccgcggactgggcagcaaagtggttgccgaaccgaaaaagtaa

DBGET integrated database retrieval system