KEGG   Cronobacter sakazakii CMCC 45402: P262_05205Help
Entry
P262_05205        CDS       T02955                                 

Definition
(GenBank) hypothetical protein
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
csi  Cronobacter sakazakii CMCC 45402
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csi00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    P262_05205
   00500 Starch and sucrose metabolism
    P262_05205
Enzymes [BR:csi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     P262_05205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3885474..3886883
Genome map
AA seq 469 aa AA seqDB search
MTTRTLLPAILQAVMKGQPVALGDRHYPRWHLAPVTGLMNDPNGFIHFQGRYHLFYQWNP
LGCAHQHKCWGHWSSADLTYWQHEPLALMPDEEYDRSGCYSGSAVDDNGRLTLCYTGNVK
FDDGTRTAWQCLAVQNADGGFDKLGPVMPLPGGYTGHVRDPKVWRHGEHWYMVLGAQDLE
LQGKVLLLRSDTLWNWENLGEIAGSTLGGLGEAGYMWECPDLFMLDGKAILITCPQGVTR
EEKRYLNTYPSAYLCGDLDYDTPEFRHGPLVELDAGFEFYAPQTTLADDGRRLLIGWMGV
PDGEEMLQPTVAQGWIHQMTCPRELSLRDGKLCQQPVRELATLRGEEQRLEGVAGTLSPL
AAESLELMLEAQGDVTLDFADTLRLEWTRDGLRLSRRSLASGEWQYRYWQGDARRLHILC
DRSSVEIFINDGEGVMSSRYFPAANATLGFEGDAHLRLRYWSLRACMVE
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgactacccgcacgctgctgcctgccattttacaggctgtgatgaaaggccagccggtc
gcgcttggcgatcgccactatccgcgctggcatctggccccggtgacgggcctgatgaac
gacccgaacggttttatccattttcaggggcgctaccacctgttttatcagtggaacccg
ctgggctgtgcgcatcagcataaatgctgggggcactggagttcggcggatctgacgtac
tggcaacacgagccgctggcactgatgcccgacgaagagtatgaccgcagcggctgttat
tccggcagcgcggtggatgacaacgggcggctgacgctctgctataccggcaacgtgaag
tttgacgacggcacccgcaccgcctggcagtgtctggcggtgcagaacgcggacggcggt
ttcgacaagctaggcccggtgatgccgctgcccggcggctataccggccacgtgcgcgac
ccgaaagtgtggcgtcacggcgagcactggtacatggtgctgggcgcgcaggatctggaa
ttgcagggcaaagtgctgctgctgcgctccgacactctgtggaactgggaaaacctgggc
gagatcgccggcagcacgctcggcgggcttggcgaggcgggctacatgtgggagtgcccg
gaccttttcatgctggacggcaaagcgattctgatcacctgcccgcagggggtaacgcgc
gaagaaaaacgctatctcaacacctatccgagcgcgtacctgtgcggcgatctcgattac
gacacgccggaatttcgtcatggcccgctggtggagctggacgccggctttgaattttac
gcgccgcaaaccacgctggccgacgatggccgccggttacttatcggctggatgggcgtg
ccggacggcgaagagatgttgcagccaacggtggcgcagggctggatccatcagatgacc
tgcccgcgcgaactctcgcttcgcgacggcaaactctgccagcagccggtacgcgaactt
gccacgctgcgcggcgaggaacagcgcctggagggcgtggccggcacgctctcaccactc
gcggcggaaagcctggagctgatgctggaagcgcagggcgacgtcacgctcgatttcgcc
gacaccctgcgtctcgagtggacgcgcgacggtctgcggctttcgcgccggagcctcgcc
agcggcgaatggcagtatcgctactggcagggcgacgcccgccgcctgcacattctgtgc
gaccgttccagcgttgagattttcattaacgacggcgaaggcgtgatgagcagccgctat
ttcccggcggccaacgcgacgcttggttttgaaggcgacgcgcatctccggctgcgctac
tggtcgttacgcgcctgcatggtagaatga

DBGET integrated database retrieval system