KEGG   Cronobacter sakazakii CMCC 45402: P262_05576Help
Entry
P262_05576        CDS       T02955                                 

Definition
periplasmic alpha-amylase
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
csi  Cronobacter sakazakii CMCC 45402
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    P262_05576
Enzymes [BR:csi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     P262_05576
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4196587..4198617
Genome map
AA seq 676 aa AA seqDB search
MNLSPLALLLLPGIALAQWSAPDLPAFQEKTPGVFTSQGPLAKGAQPLRLTMDNACWQPA
GPVKLNQMLSLTPCVDPAPEWRRFRDGNYKVQIDTRSGTPTLMLSVEQEAQKAVAEVTRQ
CPKWDGKPLTVSVKETFPEGSVVRDFYSGNTATVTQGQITLTPAPGSNGLLLLERAEASS
QAAFNWHNATVYFVLTDRFVNGDPTNDNSYGRHKDGMQEIGTFHGGDLKGLTSKLDYLQT
LGVNALWISSPLEQIHGWVGGGTKGDFPHYAYHGYYPQDWTKLDANMGTPDDLRQLVDEA
HRRGIRVLFDVVMNHTGYATLADMQQFQFGALYLKGDELKKTLGENWTDWRPGQGQNWHS
FNDYINFSDKAAWEKWWGKKWIRTDIGDYDSPGFDDLTLSLTFLPDLKTESTQPSGLPNF
YQHKPDTAAQLIDGATPRDYLTRWLSQWVRDYGIDGFRVDTAKHVELAAWQQLKNEASAA
LVEWKAKNPDKKPDDAPFWMTGEAWGHGVMQSDYYRHGFDAMINFDYQEQAAKAADCFAN
IDMVWQQMAEKLQGFNALSYLSSHDTRLFREGGPRAAELLLLTPGAVEIFYGDESERPFG
PTGSDPLQGTRSDMNWQDLNGKSAATLAHWQKLGQFRARHPAIGGGKQTTLSLKQGYGFI
RQQGDDTVMVVWAGQQ
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atgaacctctcccctctcgcactgctactgctgccgggcatcgcgctcgcacagtggtcc
gctcccgacctgcctgcgtttcaggaaaaaacccccggcgtatttacaagccaggggccg
ctggcgaaaggcgcgcagccgctgcgcctgacgatggataatgcgtgctggcaacccgcc
gggcctgtcaaactcaaccagatgctctcactgacgccatgcgttgacccggcccccgag
tggcggcgttttcgcgacggcaattataaggtgcagatagacacgcgatccggcacgccg
accctgatgttaagcgtcgagcaggaagcgcaaaaggcggtcgcggaagtgacacgccaa
tgcccgaaatgggacggcaaaccgctcacagtctccgtaaaagagacgttcccggaaggc
agcgtggtgcgggacttctacagcggcaataccgccacggtcacgcaggggcaaattacg
ctgacacctgcgcccggcagcaacgggcttctgctgctggagcgcgcagaagcttcttcg
caggccgcgttcaactggcataacgccaccgtctatttcgtcctgaccgatcgctttgtg
aacggcgacccgaccaatgacaacagctatggccgccataaagatggcatgcaggagatc
ggcacgtttcacggcggcgatctcaaagggctgaccagcaaactggattatctgcaaacg
ctcggcgtcaatgcattatggataagctcgccgctggagcagatccacggctgggtcggc
ggcggcactaaaggcgatttcccacattacgcctaccacggctactacccgcaggactgg
acgaaactggatgccaacatgggcacgccggacgatttacgccagctggtcgatgaagcg
caccggcgcggcattcgtgtcttattcgatgtggtgatgaaccacacgggctacgccacg
ctcgccgatatgcagcaattccagttcggcgcgctttacctgaaaggcgacgagctgaaa
aagacgctgggtgaaaactggaccgactggcgcccgggacaaggccagaactggcacagc
ttcaatgactatattaatttcagcgataaagccgcctgggaaaaatggtggggtaaaaag
tggatccgcacggatatcggtgactacgacagccccggctttgacgatctcacgctgtcg
ctcacctttttaccggacctgaaaacggaatcgacgcagccctccggcctgccaaacttt
taccagcacaagccggataccgcggcgcagcttatcgacggcgccacgccgcgcgattac
ctgacacgctggctcagccagtgggtgcgcgattacggtatcgacggtttccgcgtggat
acggcaaaacatgttgagctggccgcctggcagcagctgaaaaacgaggccagcgcagcg
ctcgttgaatggaaagcgaaaaatccggataaaaagcccgatgacgcgccgttctggatg
accggcgaggcctggggtcacggcgtaatgcagagcgattactaccgccacggcttcgat
gcgatgattaacttcgattaccaggagcaggccgcgaaagccgccgactgcttcgcgaat
atcgatatggtctggcagcagatggcggaaaaactccaggggttcaatgcgctgagctat
ctctcttctcacgatacacgattgttccgcgaaggcgggccgcgggcggcagaactgctt
ttgctcacgcccggcgcggtggagattttttacggcgacgaaagtgagcggcctttcggc
ccaaccggctccgatccgctccagggtacgcgatccgatatgaactggcaggatctcaat
ggcaaaagcgcggcgacgctcgcgcactggcaaaaactcgggcagttccgcgcgcgtcac
ccggccattggcggcggtaagcagaccacgctttcgctgaaacagggctatgggtttatc
cgccagcagggtgacgataccgtcatggtcgtctgggccggccagcagtaa

DBGET integrated database retrieval system