KEGG   Cronobacter sakazakii ES15: ES15_0253Help
Entry
ES15_0253         CDS       T02119                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
csk  Cronobacter sakazakii ES15
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csk00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ES15_0253 (malQ)
Enzymes [BR:csk01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     ES15_0253 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
285734..287842
Genome map
AA seq 702 aa AA seqDB search
MESKRLDSSALAAGISPNYINAHGKPQAIGAETKRRLLEAMNPEAAPKAADKSPLPPVKV
VAKSRRMQLTPQGRGDYHWLLTSETGEQFSGNARGGEALTLPAKLDEGYHTLTLTRDDSR
WHCRLIVAPKRCYEPQALREGKKLWGACVQLYTLRSQNNWGIGDFGDLQAMLNEVGPRGG
AFIGLNPIHALYPANPESASPYSPSSRRWLNVIYIDVNAVEDFRRSDEAQAWWKLKSTQQ
ALKAARESQWVDYSTVTMLKLTALKMAWARFSTRGPDDDDVVAFRDFVARAGESLYWQAA
FDAIHAWQAQEDPMRWGWPAWPKAYQNTSSPEVQAFCKNRADEVDFYLWLQWLAYEQFAR
CWQTSQSHGMPIGLYRDLAVGVAEGGAETWCDRELYCLKASVGAPPDILGPLGQNWGLPP
MDPHVMQARAYEPFIELLRANMTNCGALRIDHVMSLLRLWWIPYGETADKGAYVQYPVDD
LLAILALESQRHRCMVIGEDLGTVPAEIVGKLRDSGVYSYKVLYFENEGGSRFRAPKRWT
SQAMAVATTHDLPTLRGYWESGDLTLGKTLGLYPDEEVLKGLYADRERAKQGLLESLHQH
GCLPKRAGHHAARMKMGATLNRALQRYIADSNSALLGLQPEDWLDMAQPVNVPGTSDQYK
NWRRKLTVGLEAMFADDTVNRLIKDLDKRRRVASAGKPAKRK
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcaaacgccttgactcctccgcccttgcggcggggattagccctaactacatc
aatgcgcacggcaaaccgcaggcgattggcgctgagaccaaacggcgtttgctggaagcg
atgaacccggaggccgcgccgaaagcggccgataaatcgccgctgccgccggtaaaagtg
gtggcaaagagccgccgtatgcagttaacgccgcagggccgcggcgattaccactggctg
ctcaccagcgaaaccggcgagcagtttagcggcaacgcgcgcggcggcgaggcgctgacg
ctgccggcgaagcttgacgaggggtatcacacgctgacgctcacgcgtgacgacagccgc
tggcactgtcggcttatcgtcgccccgaagcgctgctatgagccgcaggcgctgcgtgag
ggtaaaaaactctggggcgcgtgcgtccagctttatacgctgcgctcgcaaaataactgg
ggcatcggggatttcggcgatctgcaagcgatgctgaatgaagtgggcccgcgcggcggc
gcgtttatcggtttaaacccgattcacgcgctctatccggcgaacccggagagcgcgagc
ccgtacagtccgtcgtcccgccgctggcttaacgtcatttacatcgacgtgaacgcggtg
gaggattttcggcgcagcgatgaggcgcaggcgtggtggaagcttaagtccacgcagcag
gcgctgaaagcggcccgcgagtcgcagtgggtcgattattcgaccgtgaccatgctcaag
ctcaccgcgctgaaaatggcctgggcgcgcttctccacgcgcggcccggatgatgacgat
gtggtggcgtttcgcgatttcgtggcgcgcgcgggcgaaagcctctactggcaggcggcg
ttcgacgccattcacgcctggcaggcgcaggaagatccgatgcgctggggctggcccgcc
tggccgaaagcgtatcagaacaccagcagcccggaagtgcaggcgttttgtaaaaaccgc
gctgatgaggtcgatttctacctctggctgcaatggctcgcgtatgagcagtttgcccgc
tgctggcagaccagtcagtcgcacggtatgccgatcgggctgtatcgcgatctggcggtc
ggcgtggcggaaggcggcgcggaaacctggtgcgaccgcgagctgtactgtctgaaagca
tcggttggcgcgccgccggatattctggggccgctcggccagaactggggcctgccgccg
atggatccgcacgtgatgcaggcgcgcgcttacgagccgtttatcgagctgctgcgcgcc
aatatgacgaactgcggcgcgctgcgcatcgatcatgtgatgtcgctgctgcgcctgtgg
tggatcccgtatggcgaaacggcggataaaggcgcgtatgtgcagtatccggtcgacgat
cttctggcgatcctcgcactcgaaagccagcgccatcgctgcatggtgatcggcgaagat
ctcggtacggtgccggcggaaatcgtcggcaagctgcgcgacagcggcgtctattcgtac
aaagtgctctactttgaaaacgaaggcggcagccgcttccgcgcgccaaagcgctggacg
tcgcaggcgatggcggtcgcgaccacgcacgatctgccgacgctgcgcggttactgggag
agcggcgatttaaccctcggaaaaacgctggggctttatcccgacgaagaggtgttaaag
gggctgtacgccgatcgcgagcgggccaaacaggggctgctggagagcctgcaccagcat
ggctgcctgccgaaacgcgcagggcatcacgccgcgcgcatgaaaatgggcgccacgctt
aaccgcgctcttcagcgctatatcgccgacagcaacagcgcgctgctcggtctgcagccg
gaagactggctggatatggcgcagccggtcaacgtgccgggcaccagcgaccagtataaa
aactggcggcgcaagctcaccgtcgggctggaagcgatgtttgctgatgacaccgtgaac
cggttgattaaagatctggataaacgtcgccgcgtcgcgtcggcggggaagccagcaaaa
cgtaagtaa

DBGET integrated database retrieval system