KEGG   Cronobacter sakazakii ES15: ES15_0372Help
Entry
ES15_0372         CDS       T02119                                 

Gene name
aceB
Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
csk  Cronobacter sakazakii ES15
Pathway
csk00620  Pyruvate metabolism
csk00630  Glyoxylate and dicarboxylate metabolism
csk01100  Metabolic pathways
csk01110  Biosynthesis of secondary metabolites
csk01120  Microbial metabolism in diverse environments
csk01200  Carbon metabolism
Module
csk_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:csk00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ES15_0372 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    ES15_0372 (aceB)
Enzymes [BR:csk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     ES15_0372 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: AFJ97945
Position
394451..396049
Genome map
AA seq 532 aa AA seqDB search
MNQQAITAELAFSQPFGEQERQILTPEAVEFLTELVARFTPQRNDLLAARQQVQKEIDGG
KLPDFLSETASIRNSDWKIRGIPDDLRDRRVEITGPVERKMVINALNANVKVFMADFEDS
LAPAWNKVIEGQINLRDAIKGTITWTNEAGKIYQLKPDPAVLICRVRGLHLPEKHVTWRD
EPVPGSLFDFALYFFHNYKNLLAKGSGPYFYLPKTQSWQEAAWWSDVFSYAEDRFNLPRG
TIKATLLIETLPAVFQMDEILHALRDHIVGLNCGRWDYIFSYIKTLKNHPDRVLPDRQSV
TMDKPFLSAYSRLLIKTCHRRGAFAMGGMAAFIPSKDTERNNWVLNKVKADKELEAANGH
DGTWIAHPGLGDTVMAVFDAALGEHKNQLHVLRENDAPITAAQLLEPCPGERTEEGMRAN
IRVAVQYIEAWISGNGCVPIYGLMEDAATAEISRTSIWQWIHHQKTLSNGSTVTKDLFRQ
MLAEEMRVIQEELGEQRYSHGRFDEAARLMEQITTSDELIDFLTLPGYRLLA
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaacaggcaattaccgcagaactggctttcagccagccttttggcgagcaggaa
cggcagatcctgacgccggaggccgtcgagtttcttactgaactggtggcgcgtttcacg
ccgcaacgtaacgatttgctcgccgcacggcaacaggtgcagaaagaaattgatggcgga
aagctgccagactttctttcggaaacagcttccataagaaacagtgactggaaaattcgc
ggtattcctgacgatcttcgtgaccgccgcgtcgaaatcaccggcccggtcgagcgcaaa
atggtcatcaatgcgctgaatgctaacgtcaaagtattcatggcggattttgaagattcc
ctggcacccgcctggaacaaagtcatcgaagggcagatcaacctgcgtgatgcgataaag
ggcacaattacctggaccaacgaggcgggcaaaatttatcagctcaagcctgaccctgct
gtgcttatctgccgtgtacgcggcctgcatctgcctgaaaaacatgttacctggcgcgac
gagcccgtgcctggcagcctgttcgatttcgcgctctacttcttccataactataaaaat
ctgctggccaaaggcagcggcccctatttctacctgccgaaaacgcagtcctggcaggag
gcggcctggtggagcgacgtcttcagctatgccgaagatcgctttaacctgccgcgcggc
accatcaaagccacactgcttattgaaacgttgcctgccgttttccagatggacgagatc
ctgcacgcgctgcgtgaccatatcgtcggcctcaactgtgggcgctgggattacatcttc
agctatatcaaaacccttaaaaatcaccccgaccgcgtcctgccggacagacaatccgtc
accatggataagcctttcctgagcgcttattcgcggctgctcattaaaacctgtcatcgc
cggggcgcgttcgcgatgggcggcatggcggcgttcatcccgagcaaagataccgagcga
aataactgggtgcttaacaaagtgaaggcggataaagagctggaagccgcgaacggtcac
gacggcacctggattgctcaccccggccttggcgatacggtcatggcggtttttgacgcc
gcgctgggcgagcataaaaaccagttgcatgtattgcgtgaaaacgacgcgcccatcacc
gccgcgcagctgcttgagccatgccctggcgagcgcacggaagaggggatgcgcgccaat
attcgcgtggcggtgcagtacatcgaagcctggatttccggcaacggctgcgtaccgatt
tatggcctgatggaagatgccgcgacggcggaaatctcacgcacctccatctggcagtgg
atacaccaccagaaaacgctcagcaacggcagcacagtcaccaaagatctgttccgccag
atgctggccgaagagatgcgcgtcattcaggaggagcttggcgagcagcgctacagccac
ggccgttttgacgaggccgcgcggctgatggagcaaatcaccacgtctgatgaactcatc
gacttcctgacgctgccgggctatcgcctgctggcctga

DBGET integrated database retrieval system