KEGG   Cronobacter sakazakii ES15: ES15_0521Help
Entry
ES15_0521         CDS       T02119                                 

Gene name
cysQ
Definition
adenosine-3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
csk  Cronobacter sakazakii ES15
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:csk00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
553444..554187
Genome map
AA seq 247 aa AA seqDB search
MLEQICQLAREAGSAIMEVYEGHKPLEATQKVDDSPVTAADIAAHAVIVAGLKALTPQVP
VLSEEDPPGWDVRQHWQRYWLVDPLDGTKEFLKRNGEFTVNIALIEDGKPVLGVVYAPVL
NVMYSAAEGKAWKEECGVRKQIQVRDARPPRVVISRSHGDNAELQDYLQQLGEHQTTSVG
SSLKFCLVAEGEAQLYPRFGPTNIWDTAAGHAVAVAAGAQVHDWQGKTLDYTPRESFLNP
SFRVTIY
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgttagaacagatttgccaactggcgcgcgaagccggcagcgccatcatggaagtctac
gagggtcacaaaccgctggaagccacccaaaaggttgatgattcgccggtgacggcggcg
gatatcgcagcgcacgcggtgattgtcgccgggctgaaagcgctgacgccgcaggtgccg
gtgctctccgaagaagatccgccaggctgggacgtgcgtcagcactggcagcgctactgg
ctggtggacccgcttgacggcaccaaagagtttctcaagcgcaacggcgaattcaccgtt
aatatcgcgctgattgaagacggcaagccggtgcttggcgtggtctacgcgcccgtgctg
aacgtcatgtacagcgcggcggaaggcaaggcgtggaaagaagagtgcggcgtgcgcaag
cagatccaggtgcgcgacgcgcgtccgccgcgtgtggtgataagccgctcccacggcgat
aacgccgaattgcaggattatctgcaacaacttggcgaacaccagaccacatccgtaggc
tcgtcgctgaagttctgcctggtagcggaaggagaagcgcagctttatccgcgtttcggg
ccgacgaatatttgggatacggcggcaggccacgccgtggcggtcgccgccggggcgcag
gttcacgactggcagggcaaaacgctggattacacgccgcgtgagtcgttcctgaacccc
agcttccgggtcactatttactga

DBGET integrated database retrieval system