KEGG   Cronobacter sakazakii ES15: ES15_0711Help
Entry
ES15_0711         CDS       T02119                                 

Gene name
dsbC
Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
csk  Cronobacter sakazakii ES15
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
749500..750219
Genome map
AA seq 239 aa AA seqDB search
MKKTIALLSVTLAAFSGFAQADDAAIKQSLTKLGVANAEIQPSPLAGMKTVLTESGVIYV
TEDGKHIIQGPLYDVSGGQPVNVTNQMLMTKLNALEKEMIVYKAPQEKHVITVFTDITCG
YCHKLHEEMKDYNALGITVRYLAFPRQGPRSETAKDMQAIWCAKDRNKAFDNAMSGGKVE
AASCDVDTAKHYELGVQFGVQGTPAIVLSNGAMVPGYQGPKEMKAFLDEHQKQLQASGK
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaactattgcgctgctctccgttacgctggcggctttttcaggatttgcccag
gcggatgacgcagccattaagcagtcgctcaccaaactcggtgtagcgaacgctgaaatt
cagccgtctccgctggcaggcatgaaaaccgtactgaccgaaagcggcgttatctatgtg
actgaagacggtaaacatatcattcagggcccgctgtatgacgtcagcggcggccagccg
gtcaacgtgaccaatcagatgctgatgaccaaactcaacgcgctcgaaaaagagatgatt
gtttataaagcgccgcaggaaaaacatgtcatcaccgtctttaccgatatcacctgtggc
tattgccataagctgcatgaagagatgaaagactataacgcgctgggcatcaccgtgcgc
tacctggctttcccgcgtcaggggccgcgcagcgaaacagcgaaagatatgcaggctatc
tggtgcgcgaaagatcgtaataaagccttcgataacgcgatgagcggcggcaaagttgaa
gcggcaagctgcgacgtcgacaccgcgaaacattatgagctcggcgtgcagtttggcgtc
cagggcacaccggcgatcgtgctgagcaacggtgcgatggtgccgggctatcaggggcca
aaagagatgaaagcgtttcttgatgagcatcagaaacagcttcaggcgagcggaaagtaa

DBGET integrated database retrieval system