KEGG   Cronobacter sakazakii ES15: ES15_0756Help
Entry
ES15_0756         CDS       T02119                                 

Gene name
recD
Definition
exonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
csk  Cronobacter sakazakii ES15
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:csk03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
803519..805354
Genome map
AA seq 611 aa AA seqDB search
MKMHQLIQQAVVQKLLRPLDAQFAMMVASDDEPAVMLAASLVSRDAGEGHVCLPLSRLCA
THCFAGRHDEMAQTLFEAAGNPDDWRSLLLASPAVSEDDAPTPLKLIGERLYLNRMWRHE
RAVAAFFRERNHSIELEEARLSAVLEALFGPPGDEVDWQKVAAAVALTRRISVISGGPGT
GKTTTVAKLLAAMVQLSEEKLPRIRLAAPTGKAAARLTESLGAALRRLPLSDAQKNALPE
EASTLHRLLGAQPGSQRLRYHEGNPLHLDVLVVDEASMIDLPMMARLIAALPDHARVIFL
GDRDQLASVEAGAVLGDICHYVNHGFTTERATELARITGCHINGGEPHPAGALRDCLCLL
QKSYRFGSDSGIGQLAFAVNRSDHRAARATFSRGFDDIACKTLAGNDDYAQMIDETLAGY
ERFLTLVRERAEPEAILAAFSEFQMLCALREGPFGVAGLNERVEHALAQRRLIRRTPLSR
WYEGRPVMISRNDSALGLFNGDIGVALDRGDGLRVWFPMPGGKLKPVVPSRLPDNDTAWA
MTVHKSQGSEFDHAALLLPGQFAPVVTRELVYTAITRARRRLSLYADERVLEMAIATRTE
RRSGLMACFEQ
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgcatcaactgatccagcaggccgtagtgcaaaagcttctgcgcccgctggat
gcccagttcgcgatgatggtggcaagcgatgatgaaccggcggtgatgctcgccgcctcg
ctggtgagccgcgacgccggtgaaggccacgtctgtctgccgctctcccggctgtgtgcg
acgcactgcttcgccgggcgtcacgatgaaatggcgcaaacgctgtttgaggcggcgggc
aatccggacgactggcgctcgctgttactggcatcgcctgcggtgagtgaggacgacgcg
ccgacgccgctgaagctcatcggcgagcgtttgtatctgaaccgtatgtggcgtcatgag
agggcggtcgcggcgttctttcgcgagcgtaaccatagtattgaactggaagaagcgcgc
ctgagcgcggtactggaggcgctttttgggccaccaggcgatgaagtggactggcagaaa
gtggcggcggcagtcgcgctcacccggcgcatctcggtgatttccggcgggccgggcacc
gggaaaaccaccacggtggcgaaactgctggcggccatggtgcagctctcggaagagaaa
ctgccgcgtatccgccttgccgcgccgaccggtaaagccgcggcgcgcctgacggaatcg
ctcggtgctgcgctgcgtcgtttgccactgagcgacgcgcagaaaaacgcgctgccggaa
gaagccagcacgctgcaccgcctgctgggtgcgcagccgggcagccagcgtctgcgctac
cacgaaggtaacccgctgcatctggatgttctggtggtggatgaggcttcgatgatagac
ctgccgatgatggcgcggcttatcgcggcgctgccggaccatgcgcgggtgattttttta
ggcgatcgcgatcagctggcgtccgtggaagcgggcgcggtgctcggtgatatctgccac
tacgtgaaccacggttttaccactgaacgcgccaccgagcttgcccgcatcacggggtgt
cacattaacggcggcgagcctcatccggcaggcgcgctgcgcgactgcctgtgcctgctg
cagaaaagctatcgttttggcagcgattccggcatcggccagctcgcgtttgctgttaat
cgcagcgatcatcgcgccgccagagcgacgtttagccggggatttgacgatatcgcctgc
aaaacgctggcgggtaacgacgattacgcacagatgattgacgagacgctggcaggctac
gagcggttcttaacgctggtccgcgagcgtgccgagccggaggccattcttgcggccttc
agcgaattccagatgctctgcgcgctgcgtgaagggccgttcggcgtcgccgggcttaac
gagcgtgtggaacatgcgctggcgcagcggcggctgattcgtcgcacgccgctgtcgcgc
tggtatgaagggcggccggtgatgatttcgcgcaacgacagcgcgctggggctgtttaac
ggcgatatcggcgtggcgctggatcgtggcgatggcctgcgcgtctggttcccgatgccc
ggcggcaagctgaaacccgtcgtgccaagccgcttgccggataatgacaccgcgtgggca
atgacggtgcataaatcacagggttcggagttcgatcatgcggcgctgctcctgccgggg
cagttcgcgccggtggtcacgcgagagctggtctatacggcgattacgcgcgcgcggcga
cggttgtcgctgtatgcggatgagcgggtgctggagatggccatcgcgaccagaacggaa
cggcgcagcggcctgatggcctgctttgaacaataa

DBGET integrated database retrieval system