KEGG   Cronobacter sakazakii ES15: ES15_0807Help
Entry
ES15_0807         CDS       T02119                                 

Gene name
pcm
Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
csk  Cronobacter sakazakii ES15
Brite
Enzymes [BR:csk01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     ES15_0807 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
858265..858891
Genome map
AA seq 208 aa AA seqDB search
MVNNRVQTLLNQLRAQGIKDERVLEAISRVPREKFVDEAFEHKAWENVALPIGSGQTISQ
PYMVARMTELLTLTPASRVLEIGTGSGYQTAILAHLVHHVCSVERIKSLQWHARRRLKQL
DLHNISTRHGDGWQGWQARAPFDAIIVTAAPPEIPTALLSQLDEGGILVLPVGDEQQVLK
RVRRRGSEFIIDTVEAVRFVPLVKGELA
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggtaaacaatcgtgttcagacccttctgaatcaactgcgtgctcagggcattaaagat
gaacgcgtgcttgaggcgatttcgcgcgtgccgcgtgaaaaatttgtcgatgaagcgttt
gagcacaaggcctgggaaaacgttgcgctgcctattggttcagggcaaaccatttctcag
ccttatatggtggcgcggatgaccgagcttctgacacttacgcccgcctcccgggtgctg
gaaatcggcaccggctccggctaccagacggcgattctggcccatctggtgcatcatgtc
tgttctgtcgagcgcattaaaagcctgcaatggcatgccagacggcgtttaaagcagctc
gatctgcacaatatctccacccgccacggcgatggctggcagggctggcaggcgcgcgcg
ccatttgacgctattattgtgactgccgctccgcctgaaatcccgacagccttgctgtcg
caactggacgagggcggcattctggttcttcccgtgggcgacgaacagcaggtgttaaag
cgcgttcgtcggcgggggagcgaatttattatcgacaccgtagaagccgtacgctttgtg
cctctggtaaaaggggagctggcgtaa

DBGET integrated database retrieval system