KEGG   Cronobacter sakazakii ES15: ES15_0882Help
Entry
ES15_0882         CDS       T02119                                 

Definition
phage lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
csk  Cronobacter sakazakii ES15
Brite
Enzymes [BR:csk01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     ES15_0882
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
926347..926811
Genome map
AA seq 154 aa AA seqDB search
MVAAIMLVLAGGNVRTNQEGLELIGNAEGCRVNPYVCPAGVLTDGIGNTHGVRYGKSMEQ
IAKDWERNILEAERCVIRYGAGDRLTENAFSAAVSLTFRVGCGKVKNSTLFRMFRQGEQR
ATCDQFLRWRYAAGKELPGLVTRSQKERALCLKE
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
gtggtggcggcgatcatgttggtgctggctggtgggaacgtccgaaccaaccaggaaggg
cttgagctgatcggtaatgccgaggggtgtcgcgttaatccatacgtctgcccggctggc
gtgcttaccgacgggatcggcaacactcacggcgtgcgctacggcaaatcgatggagcag
atcgccaaagactgggagcgcaacatcctggaggctgaacgctgcgtaattcgctatggc
gctggtgacaggctgaccgaaaacgcattcagcgctgccgtatctctgacgtttcgcgtg
ggctgcggcaaagtgaaaaactcgacgctgtttcgcatgttccggcagggcgaacagcgc
gccacctgcgatcagttcctgagatggcgttacgccgcaggtaaagagctgccagggctg
gttaccaggagccagaaagagcgtgcgctctgcctcaaggagtga

DBGET integrated database retrieval system