KEGG   Cronobacter sakazakii ES15: ES15_1113Help
Entry
ES15_1113         CDS       T02119                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
csk  Cronobacter sakazakii ES15
Pathway
csk00010  Glycolysis / Gluconeogenesis
csk00052  Galactose metabolism
csk00500  Starch and sucrose metabolism
csk00520  Amino sugar and nucleotide sugar metabolism
csk00521  Streptomycin biosynthesis
csk01100  Metabolic pathways
csk01110  Biosynthesis of secondary metabolites
csk01120  Microbial metabolism in diverse environments
csk01130  Biosynthesis of antibiotics
csk01200  Carbon metabolism
Module
csk_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
csk_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:csk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ES15_1113 (glk)
   00052 Galactose metabolism
    ES15_1113 (glk)
   00500 Starch and sucrose metabolism
    ES15_1113 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    ES15_1113 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    ES15_1113 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    ES15_1113 (glk)
Enzymes [BR:csk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     ES15_1113 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase PaaX_C
Motif
Other DBs
NCBI-ProteinID: AFJ98686
Position
1190829..1191794
Genome map
AA seq 321 aa AA seqDB search
MTKYALVGDVGGTNARLALCDVDSGEILKAKTYSGLDYPSLEAVVRVYLEEHNVTVTDGC
IAIACPITGDWVAMTNHVWAFSVAEMKKNLGFDHLEIINDFTAVSMAIPMLKTDHLIQFG
GGEPQPNKPIAVYGAGTGLGVAHLVHVDKRWVSLPGEGGHVDFAPNSEEEAIILEQLRAE
VGHVSAERVLSGPGLVNLYRAIVKADGRLPDNLRPKDITERALDDSCTDCRRALSLFCVI
MGRFGGNLALTLGTFGGVYIAGGIVPRFLDFFTSSGFRGGFEDKGRFKSYVQDIPVYLIV
HDQPGLLGAGAHLRQTLGQIL
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaatatgctttggtgggagacgtaggcggcaccaacgcacgcttagcgctgtgc
gacgtagacagcggcgagatactcaaggcgaaaacctattccggccttgattatccgagc
ctggaagcggtggtgcgggtgtatctggaagagcataacgttacggtgacggatggctgt
atcgccatcgcgtgtccgattaccggcgactgggtggcgatgaccaaccacgtctgggcg
ttttctgtcgccgaaatgaaaaagaatctcggcttcgatcatctggaaattattaacgat
ttcaccgccgtttctatggcgatcccaatgctcaaaaccgaccatctgatccagtttggc
ggcggcgaaccgcagcccaataaaccgatcgccgtttatggcgcgggcaccgggcttggc
gtggcgcacctcgtgcatgtggataaacgctgggtcagcctgccgggcgagggcggtcac
gtcgatttcgcgccgaacagcgaagaagaagcgattatcctcgaacagctgcgcgccgaa
gtcgggcacgtctccgccgagcgtgtactttcagggccggggcttgtgaatctctaccgc
gccattgttaaagccgatggccgtctgccggataatttgcgtccgaaagacatcaccgaa
cgcgcactggatgacagctgcaccgactgccgtcgcgcactgtcgctcttttgcgtcatc
atgggccgtttcggcggcaacctggcgctgacgctcggcactttcggcggcgtctatatc
gcaggcggtatcgtgccgcgcttcctggatttcttcacctccagcggtttccgcggcggg
tttgaagataaaggccgctttaaatcttatgtgcaggatattccggtctatctgattgtt
cacgaccagccggggctgctcggcgcgggcgcgcatctgcgccagacgctcggacagatc
ctctga

DBGET integrated database retrieval system