KEGG   Cronobacter sakazakii ES15: ES15_1327Help
Entry
ES15_1327         CDS       T02119                                 

Gene name
folE
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
csk  Cronobacter sakazakii ES15
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csk00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ES15_1327 (folE)
Enzymes [BR:csk01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     ES15_1327 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1415454..1416125
Genome map
AA seq 223 aa AA seqDB search
MPSLSKEAALVHEALVARGLETPLRPPVNELDNETRKRLIAGHMTEIMQLLNLDLSDDSL
METPHRIAKMYVDEIFSGLDYANFPKITVIENKMKVDEMVTVRDITLTSTCEHHFVTIDG
KATVAYIPKDAVIGLSKINRIVQFFAQRPQVQERLTQQVLVALQTLLGTNNVAVSIDAVH
YCVKARGIRDATSATTTTSLGGLFKSSQNTRQEFLRAVRHHNG
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgccatcactcagtaaagaagcggccctggttcatgaagcgctggtcgcgcgcggtctg
gagacgccgctgcgtccgccggtcaacgagctggataacgaaacccgcaagcgccttatc
gccggtcatatgactgaaatcatgcagctgcttaatctggatctgagcgatgacagcctg
atggaaacgccgcatcgcatcgccaagatgtatgtggatgagattttctccggcctcgat
tacgccaatttcccgaagattaccgttattgagaacaaaatgaaggtggatgaaatggtc
acggtgcgcgacatcaccctgaccagcacctgcgaacatcacttcgtgaccatcgacggt
aaagcgaccgttgcgtatatcccgaaagacgcggtgatcggcctttcaaaaatcaaccgc
atcgtgcagttcttcgcccagcgcccgcaggtgcaggagcgactgacgcagcaggtactg
gtggcgctgcaaacgctgcttggcacgaataatgtggcggtctccatcgacgcggtgcac
tactgcgtgaaagcgcgcggcatccgcgacgccaccagcgcgaccaccacgacctcgctc
ggcgggctgtttaaatccagccagaacacgcgccaggaatttctgcgcgccgtgcgtcac
cacaacggctaa

DBGET integrated database retrieval system