KEGG   Cronobacter sakazakii ES15: ES15_1525Help
Entry
ES15_1525         CDS       T02119                                 

Gene name
dcyD
Definition
D-cysteine desulfhydrase
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
csk  Cronobacter sakazakii ES15
Pathway
Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:csk00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    ES15_1525 (dcyD)
Enzymes [BR:csk01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.15  D-cysteine desulfhydrase
     ES15_1525 (dcyD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1629735..1630715
Genome map
AA seq 326 aa AA seqDB search
MQNLTRYARLELIGAPTPLEFLPRLSDYLGREIFIKRDDAMPVAMGGNKLRKLEFLAAQA
LREGADTLVTAGAIQSNHVRQTAAVAARLGLHCVALLENPIATREENYLTNGNRLLLDLF
NVQVEMCDALDAPDQQLDELAVRLEAQGFRPYVIPVGGSNVLGALGYVESTLEIVQQCEG
VVRPSSVVVASGSAGTHAGLAVGLEQGMPEAELIGVTVSRSVAAQKPKVVALQQGVAKAL
ELEARADILLWDDYFAPGYGVPNDEGMEAVKLLARLEGILLDPVYTGKAMAGLIDGIAQN
RFKDNGPILFIHTGGAPALFAYHPHV
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatcttacccgctatgcgcgccttgagcttatcggcgcgcccacgccgctggag
tttctgccgcgcctgtctgactacctgggccgcgaaattttcatcaagcgcgatgacgcg
atgccggtggcgatgggcggtaataagctgcgcaagctggagtttctcgcagcccaggcg
ctgcgcgaaggggccgacacgctggtgacggcgggcgcgatacagtcgaaccatgtgcgc
cagacggcggcggtggccgcgcgcctcggcctgcactgcgtggcgctgctggaaaacccg
attgccacgcgcgaagagaattacctcactaacggcaaccggctgctgctggatctcttt
aatgtgcaggtcgagatgtgcgacgcgctggacgcgccagaccagcagcttgacgagctg
gcggtgcgccttgaagcgcagggcttccggccttatgtcattccggttggcggctcgaac
gtgctgggcgcgctcggctatgtcgaaagcacgcttgagatcgtacagcagtgcgaaggc
gtggtgcgcccgtcatccgtagtggtcgcctccggcagcgccggaacgcacgcggggctc
gccgtcgggctggagcaggggatgccggaggctgaacttatcggcgtgacggtctcgcga
agcgtcgccgcgcagaagccgaaagtcgtcgcgctgcagcagggcgttgcaaaagcgctg
gagctggaagcgcgcgccgatattttactgtgggatgactatttcgcgccgggttacggc
gtgccgaacgacgagggcatggaagcggtgaagctgctggcgcgtctcgaaggcattttg
cttgacccggtttataccggcaaagcgatggccgggcttattgacggcatcgcgcagaac
cgttttaaagataacggcccgattctctttattcacaccggcggcgctccggcgctgttc
gcgtaccatccgcatgtctga

DBGET integrated database retrieval system