KEGG   Cronobacter sakazakii ES15: ES15_1566Help
Entry
ES15_1566         CDS       T02119                                 

Gene name
cheB
Definition
chemotaxis-specific methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
csk  Cronobacter sakazakii ES15
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:csk00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    ES15_1566 (cheB)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    ES15_1566 (cheB)
Enzymes [BR:csk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     ES15_1566 (cheB)
Two-component system [BR:csk02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   ES15_1566 (cheB)
Bacterial motility proteins [BR:csk02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    ES15_1566 (cheB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1671631..1672680
Genome map
AA seq 349 aa AA seqDB search
MSKIRVLSVDDSALMRQIMTEIINSHSDMEMVATAPDPLVARDLIKQFNPDVLTLDVEMP
RMDGLDFLEKLMRLRPMPVVMVSSLTGKGSEVTLRALELGAVDFVTKPQLGIREGMLAYS
ELIADKVRTASRARISARLPDAVPKTLKAGPLLSSEKLIAIGASTGGTEAIRHVLQPLPL
SSPAVLITQHMPPGFTRSFAERLNKLCQISVKEAEDGERVLPGHAYIAPGDKHMELARSG
ANYQIKIHDGPPVNRHRPAVDVLFHSVAKHAGRNAVGVILTGMGNDGAAGMLAMHQAGAW
TIAQNEASCVVFGMPREAINMGGVSEVVDLSQVSQQMLAKISAGQAIRI
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaatcagagtgttgtcagtagatgattcggcgctgatgcgtcaaatcatgacc
gaaattatcaacagccacagcgatatggagatggtggcgacggcgccggacccgctggtg
gcgcgcgatctgattaagcagttcaacccggatgtcttaacgctggatgttgaaatgccg
cgcatggatggcctcgatttcctggaaaaactgatgcgtctgcgtccgatgccggtggtc
atggtctcttcgctgacgggaaaaggctctgaagtgacgctgcgcgcgctggagctgggc
gcggtggatttcgtgaccaagccgcagcttggcattcgtgaagggatgctggcctacagc
gaactgattgccgataaagtgcgtaccgcctcgcgtgcgcggatttccgcccgcctgccg
gacgcggtgccgaaaacgctgaaagcaggcccgctgttgagttcggaaaaactgattgcc
attggtgcctccacgggcggcaccgaagcgattcgccatgtgctccagccgctgccgctc
tcaagcccggcggtactgattacccagcacatgccgcctggatttacccgttctttcgcc
gagcgactgaacaagctgtgccagattagcgtgaaagaagccgaagacggcgagcgcgtg
ctgccgggccatgcctatatcgcgccaggcgataagcatatggagctcgcgcgcagcggc
gctaactaccagataaaaatccacgacgggccgccggttaaccggcaccgtccggccgtg
gatgtgttgtttcactccgtagccaaacatgcggggcgcaacgcggtgggcgtgatcctc
accgggatgggcaacgatggcgcggcgggaatgctggcgatgcaccaggcgggtgcctgg
accatcgcccaaaacgaagcgagttgtgtggtgttcggcatgccgcgtgaggccatcaat
atgggtggcgtcagcgaagtcgtcgatctaagccaggtcagccagcagatgctggcgaaa
atcagtgccggacaggcaatacgtatttaa

DBGET integrated database retrieval system