KEGG   Cronobacter sakazakii ES15: ES15_1760Help
Entry
ES15_1760         CDS       T02119                                 

Gene name
galU
Definition
UTP--glucose-1-phosphate uridylyltransferase subunit GalU
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
csk  Cronobacter sakazakii ES15
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:csk00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ES15_1760 (galU)
   00052 Galactose metabolism
    ES15_1760 (galU)
   00500 Starch and sucrose metabolism
    ES15_1760 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    ES15_1760 (galU)
Enzymes [BR:csk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     ES15_1760 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1872921..1873829
Genome map
AA seq 302 aa AA seqDB search
MAAINSKVKKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGITEIVLV
THSSKNSIENHFDTSFELEAMLEKRVKRQLLEEVQSICPPHVTIMQVRQGLAKGLGHAVM
CAHPVVGNEPVAVILPDVILDEFESDLSQDNLAEMIKRFDETGRSQIMVEPVEDVTAYGV
VDCQGAQLQPGDSVPMVGIVEKPKADVAPSNLAVVGRYVLGADIWPLLAKTPPGAGDEIQ
LTDSIAMLMDKETVEAYHMKGKSHDCGNKLGYMQAFVEYGIRHNTLGEEFKAWLNDTVGD
KK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggctgccattaattcgaaagtgaaaaaagcagtaatccctgttgcgggattaggaacc
aggatgttgccggccacgaaggcgattccaaaagagatgctgccgctggtggataaaccg
ttaattcagtatgtggttaatgagtgtattgccgctggcattactgagattgttctggtc
actcactcctcaaaaaattccatcgaaaaccacttcgataccagttttgaactcgaagcg
atgctggaaaaacgcgtgaagcgccagctgctggaagaagtgcagtctatctgcccgccg
cacgtgaccatcatgcaggtgcgtcagggcctcgcaaaaggtctgggccatgcggtgatg
tgcgcgcatccggttgtcggcaacgagccggtagcggtcattctgccagacgttattctc
gatgaatttgaatccgacctctcccaggacaacctggcagaaatgatcaaacgtttcgat
gagactggccgcagccagatcatggttgagccggtagaagacgtgactgcctacggcgtg
gtggactgccagggcgcgcaactgcagccgggcgacagcgtaccgatggtgggcatcgtt
gagaaaccgaaagccgacgtggcgccgtccaacctcgcggttgttggtcgttacgtgctc
ggcgcggatatctggcctctgctggcgaaaacgcctccgggagcaggtgatgagatccag
ctgaccgactccatcgcgatgctgatggataaagaaaccgtcgaggcgtaccacatgaaa
ggcaaaagccacgattgcggtaacaaactgggttacatgcaggcctttgtggaatacgga
attcgccacaatacgctgggtgaagagttcaaagcctggcttaacgacaccgtcggcgac
aagaagtaa

DBGET integrated database retrieval system