KEGG   Cronobacter sakazakii ES15: ES15_1787Help
Entry
ES15_1787         CDS       T02119                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
csk  Cronobacter sakazakii ES15
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:csk00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ES15_1787 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ES15_1787 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ES15_1787 (trpA)
Enzymes [BR:csk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ES15_1787 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1900582..1901391)
Genome map
AA seq 269 aa AA seqDB search
MERYQQLFDRLAARKEGAFVPFVTLGDPSPEQSLQIIDALVEGGADALELGIPFSDPLAD
GPTIQSATLRAFASGTTPDQCFEMLAAVRQKYPDLPIGLLMYANLVFSRGVDEFYARCAA
VGVDSVLVADVPVEESAPFRQAAMRHNVAPIFICPPNADDDLLRQIASYGRGYTYLLSRA
GVTGAENRAALPLNHLINKLTEYHAAPPLQGFGISEPAQVKAAIEAGAAGAISGSAIVKI
IENNLNDRAAMLESLKTFVRQLKAASLPA
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atggagcgttatcagcagctgtttgaccgcctggcagcccgtaaggaaggcgcgtttgtt
ccctttgtgacgctcggcgacccgtcgcccgagcagtcgctgcagattatcgacgcgctg
gtggaaggcggcgctgacgcgctggagctcggcattccgttctccgatccgctggcggat
ggcccgacgattcagagcgcgacgctgcgtgcgtttgcttctggcaccacgccggatcag
tgctttgaaatgctggccgcggtgcgtcagaaatacccggacttacccatcggactgtta
atgtatgccaacctggtgttcagccgcggcgtggacgagttctacgcccgctgcgccgcc
gtcggcgtcgattcggtcctggtggccgatgtgccggtggaagaatccgccccgttccgc
caggcggcgatgcgccacaatgttgcgccaattttcatctgcccgccaaatgccgatgac
gatctgctgcgccagattgcctcttatggccgcggttacacctatttgctgtcgcgtgcc
ggggtgacgggcgcggaaaaccgcgccgcgctgccgctaaaccacctgattaataaactc
accgaataccatgccgcgccgccgttgcagggcttcgggatttcggagcctgcgcaggtg
aaagccgccattgaggccggtgccgcaggcgcgatttctggctcggcgatcgtcaagatc
attgagaacaacctgaacgatcgcgcggcgatgctggagtcgctgaaaacgttcgtgcgc
cagttaaaagcggccagtttgcctgcctga

DBGET integrated database retrieval system