KEGG   Cronobacter sakazakii ES15: ES15_1829Help
Entry
ES15_1829         CDS       T02119                                 

Definition
sucrose phosphorylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
csk  Cronobacter sakazakii ES15
Pathway
Starch and sucrose metabolism
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:csk00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1947300..1949015
Genome map
AA seq 571 aa AA seqDB search
MENITPSTINIDAIKNLIARIYGDGFTTSHYETLEKHISETRKAITVPRKKGWDQTDVVL
ITYADQFSAPGEKRLATFQRFFEKWLKPYFSHIHLLPFYPWSSDDGFSVVDYHRVDPQCG
DWDDIARLNTQARLMFDFVCNHISAQSEWFADYLAQKPGYEDFFIAVDPATDLTAVTRPR
ALPLLTPFTMQNGRVRHLWTTFSEDQIDLNFASPVVLLAMVDVLLHYLREGAQYVRLDAV
GFMWKTPGTSCIHLEKTHLLVKLFRAIADVVAPCTVIITETNVPHKDNIAYLGNGFDEAQ
MVYQFPLPPLVLHAVHTQNARTLCEWAQGLSDARIGETTWFNFLASHDGIGLNPLRGILP
EDAILRLVEDLQAQGARVNWKNNPDGTRSPYEINVTYMDALSLRADSDATRLARFLLAHA
LLLTFPGVPAIYIQSILGSRNDEEGVERLGYNRAINRQKYTEAEMNTALQAEGNLRHETW
KQLGELISLRRQHAAFHPDSAFAARCINDAVLEIMRVADNGATVIALFNLSDTAQVIDYD
ARGCRELITGATINSDSLILAPWKAMWLSKA
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatataaccccttccacgataaatatcgacgcgattaaaaatctgattgcgcga
atttatggcgatggatttactacttcgcattacgaaacactcgaaaaacatatttcagaa
acgcgtaaagccattacagtgccgcgtaaaaaaggctgggatcaaaccgatgtggtatta
attacctatgccgatcagttcagcgcgcccggtgaaaaacgccttgcgacttttcagcgt
ttttttgaaaagtggttaaaaccgtatttttctcatattcatcttttgccgttttatccc
tggtcgtctgacgacggattttcggtggtggattaccaccgcgtcgacccacagtgcggc
gactgggacgatatcgcgaggcttaatacccaggcgcggctgatgtttgacttcgtctgc
aaccatatttccgcccagagtgaatggtttgcggattatctcgcgcaaaaaccgggctat
gaagatttctttattgccgttgacccggcgacggatttaaccgccgtcacccgaccgcgc
gcgttgccgttattaacgccgtttacgatgcaaaacggccgggtacgtcacctgtggacc
accttcagcgaagatcagattgacctcaatttcgccagcccggttgttctgctggcgatg
gtggatgtccttttgcattatctgcgcgaaggggcgcaatatgtccgcctcgacgccgtc
ggctttatgtggaaaacacctggaacgagctgtatccatctggaaaaaacacatctgtta
gtgaagctgttccgcgcgatcgccgatgtggtggctccgtgcactgtgatcatcaccgaa
actaacgtaccgcataaagacaatatcgcctatctcggtaacgggtttgatgaggcgcag
atggtgtaccagttcccgctgccgccgctggtgctgcatgctgttcatacccaaaatgcc
cgcacgctctgcgagtgggcgcaggggttaagtgacgcgcgtatcggtgaaaccacctgg
tttaatttcctggcgtcgcatgacggcatcgggcttaatccgctgcgcggcattcttccc
gaagacgcgattttacgcctggtggaagaccttcaggcgcaaggcgctcgggtcaactgg
aaaaataaccctgacggtacgcgcagcccgtatgaaattaacgtcacgtatatggatgcc
cttagtttacgggctgacagcgacgcgacgcgccttgcgcgttttttgctggcgcacgcg
ctgttattaaccttccccggcgttccggcgatttatattcaaagtattctcggctcgcgc
aatgatgaagagggcgttgaacggcttggctataaccgcgctattaatcgtcaaaaatat
accgaggcggaaatgaacacggcgctacaggccgaagggaatttacgccacgaaacgtgg
aagcaactcggcgagcttatttcgcttcgccgccagcacgcggcgtttcatcccgacagc
gcctttgccgcgcgctgtattaatgatgcagtgctggaaattatgcgcgttgcagataat
ggcgcgacggtcattgccctctttaatctcagcgataccgcgcaggttattgattatgac
gcccgcggctgtcgtgaattaatcaccggcgcgacgataaatagtgactcgctgattctt
gccccatggaaagcaatgtggcttagcaaagcctga

DBGET integrated database retrieval system