KEGG   Cronobacter sakazakii ES15: ES15_1866Help
Entry
ES15_1866         CDS       T02119                                 

Gene name
adhP
Definition
alcohol dehydrogenase AdhP
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
csk  Cronobacter sakazakii ES15
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:csk00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    ES15_1866 (adhP)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ES15_1866 (adhP)
  Lipid metabolism
   00071 Fatty acid degradation
    ES15_1866 (adhP)
  Amino acid metabolism
   00350 Tyrosine metabolism
    ES15_1866 (adhP)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    ES15_1866 (adhP)
   00626 Naphthalene degradation
    ES15_1866 (adhP)
Enzymes [BR:csk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     ES15_1866 (adhP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1985263..1986294
Genome map
AA seq 343 aa AA seqDB search
MKVMKMKAAVVKAFGQPLEIQEVLVPEVTPGKVLVKIAATGVCHTDLHAAEGDWPVKPNP
PFIPGHEGVGHVVAVGQGVTHIKEGDRVGVPWLYSACGHCEHCLGGWETLCHGQQNSGYS
VNGSFAEYCLADANYVGILPDNVEFTHIAPILCAGVTVYKGLKMTDTKPGDWVVVSGIGG
LGHLAIQYANAMGLNVAAVDIDNDKLEFAKRLGAQVTANALEVDPGSYFHDTFGGAHGVL
VTAVSPKAFAQATTMMRRGGTMVLNGLPPGKFDLSIFDMVLDGTTVRGSIVGTRKDLQEA
LDFAGHNKVAAEIAVEPLENINDIFDRMRNGKITGRIVVDMSL
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtgatgaaaatgaaagcggccgtggtcaaggccttcgggcagccgctggagatc
caggaagtgctggtgccggaagtcacaccaggtaaagtgctggtgaaaatcgcggcgacc
ggcgtgtgtcataccgatctccacgcggcggaaggtgactggccggtgaaaccgaacccg
ccatttattccgggccatgaaggcgtggggcatgtcgtggcggtcggccagggcgtgacg
cacattaaagagggcgatcgcgttggcgtgccgtggctctattccgcctgcgggcactgc
gaacactgtctcgggggctgggaaacgctctgccacggccagcaaaactccggctattcg
gttaacggcagcttcgccgagtattgtctggcagacgccaattatgtgggcatcctgccg
gataacgtcgagtttacccatatcgcgccgatcctctgtgcgggggtgacggtttataaa
gggctgaaaatgaccgacaccaaaccgggtgactgggtggtggtttccggcatcggcggg
ttagggcatctggcgattcagtacgccaacgcgatggggctgaacgtggcggcggtggat
attgataacgataagctggagtttgcgaaacgcctcggcgcgcaggtgacggccaacgcg
ctggaggtcgatccgggcagctatttccatgacactttcggcggcgcgcacggcgtgctg
gtaacggcggtgtcgccaaaagcgttcgcccaggcgaccaccatgatgcgccgcggcggt
acgatggtgctgaacggcctgccgccgggtaaattcgatctctctatctttgatatggtg
ctggacggcaccacggtgcgcggttcgattgtcggtacgcgtaaggatctccaggaggcg
cttgatttcgcgggtcataataaagtggcggcggaaattgcggtcgagccgctggagaat
atcaacgatattttcgaccgtatgcgcaacgggaaaatcaccggccgcatcgtggtggat
atgtcgctgtaa

DBGET integrated database retrieval system