KEGG   Cronobacter sakazakii ES15: ES15_2112Help
Entry
ES15_2112         CDS       T02119                                 

Gene name
folB2
Definition
dihydromonapterin reductase
Orthology
K13938  
dihydromonapterin reductase / dihydrofolate reductase [EC:1.5.1.- 1.5.1.3]
Organism
csk  Cronobacter sakazakii ES15
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csk00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ES15_2112 (folB2)
   00670 One carbon pool by folate
    ES15_2112 (folB2)
Enzymes [BR:csk01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     ES15_2112 (folB2)
    1.5.1.-  
     ES15_2112 (folB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2249690..2250412
Genome map
AA seq 240 aa AA seqDB search
MVKKLDKPIVITGAGRRIGLALAHHFLAQHHDVIVSYRTRYPAIDVLEEAGAVCIEADFC
HDEGILAFADAVKARTTHIRALLHNASTWQDESPPVPPAEVLNAMLQIHVHAPYLLNFAL
EPLMRGQGHAACDIIHFTDYVVERGSAKYIAYAASKAALDNLTRSFARKLAPEVKVNAIA
PSQILFNEHDDPEYRQKALNKSLMKIAPGEKEIIDLVDYLLTSRYVTGHSYPVNGGRPLR
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
gtggtgaaaaaactggataaacccattgttatcaccggcgcgggccgccgtatcggcctt
gcgctggcgcaccatttcctggcgcagcatcatgatgtgattgtcagttaccgcacccgt
tacccggcgattgacgtgctggaagaggcaggcgcggtgtgcatcgaagccgatttctgc
catgacgagggcattctggcgtttgccgacgccgtaaaagcgcgcaccacgcatattcgc
gcgctgttgcataacgccagcacctggcaggatgaaagtccgcctgtgccgcccgctgag
gtgctgaacgccatgctgcaaattcacgttcacgcgccctatctccttaactttgccctg
gagccgctgatgcgcggccagggccacgccgcctgcgatattattcactttaccgattat
gtcgtggagcgcggcagcgcgaagtatatcgcctatgccgccagcaaagcggcgctcgat
aatctcacccgttcgtttgcccgcaagcttgcgccggaggtcaaagttaacgccatcgcc
ccgtcgcaaatcctctttaacgaacatgacgacccggaataccggcagaaggcgctgaat
aaatcgctgatgaaaatcgcgcccggcgaaaaagagattatcgacctggtggattatctc
ctcaccagccgctatgtgacgggccacagctatccggtgaacggcggccgcccgttgcgt
taa

DBGET integrated database retrieval system