KEGG   Cronobacter sakazakii ES15: ES15_2267Help
Entry
ES15_2267         CDS       T02119                                 

Gene name
btuE
Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
csk  Cronobacter sakazakii ES15
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:csk00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:csk00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2430550..2431101)
Genome map
AA seq 183 aa AA seqDB search
MQHDILNTEVTTIDGETISLEQYKGKVLLIVNVASKCGLTPQYEQLENIHKAWEPSGFRV
LGFPCNQFLGQEPGSEDEIKTFCSTTYGVTFPMFSKIDVNGDNRHPLYQKLIAAAPKAVA
PEQSGFYERMASKGRAPLYPDDILWNFEKFLVGRDGQVIQRFSPDMTPEDPIVMEAIKLA
LAK
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgcaacacgacattctgaataccgaagtgaccaccattgacggtgaaaccatttcgctt
gagcagtacaaaggcaaagtgctgctgatcgttaacgtcgcctcaaagtgcgggctgacg
ccccagtatgagcagctggaaaatattcacaaagcctgggagccgtccggctttcgcgta
ctgggtttcccctgcaaccagtttctgggccaggagccgggcagcgaagacgagatcaaa
acgttctgcagcaccacttacggcgtgacgttccccatgttcagcaaaatcgacgtcaac
ggcgacaaccggcacccgctgtatcagaagctcatcgccgccgcgccgaaagctgtcgcg
ccggagcaaagcggtttttatgagcgtatggcgagtaaaggccgcgcgccgctttacccg
gacgacatcctgtggaactttgaaaaattcctcgtgggccgcgacggtcaggtgatccag
cgcttctcgccggatatgacgccggaagatcccatcgtaatggaagccattaagctggcg
ctggcgaagtaa

DBGET integrated database retrieval system