KEGG   Cronobacter sakazakii ES15: ES15_2285Help
Entry
ES15_2285         CDS       T02119                                 

Gene name
pfk2
Definition
6-phosphofructokinase
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
csk  Cronobacter sakazakii ES15
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:csk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ES15_2285 (pfk2)
   01230 Biosynthesis of amino acids
    ES15_2285 (pfk2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ES15_2285 (pfk2)
   00030 Pentose phosphate pathway
    ES15_2285 (pfk2)
   00051 Fructose and mannose metabolism
    ES15_2285 (pfk2)
   00052 Galactose metabolism
    ES15_2285 (pfk2)
  Energy metabolism
   00680 Methane metabolism
    ES15_2285 (pfk2)
Enzymes [BR:csk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     ES15_2285 (pfk2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2447951..2448880
Genome map
AA seq 309 aa AA seqDB search
MVRIYTLTLAPSLDSATITPQIYPEGKLRCSAPVFEPGGGGINVARAIVHLGGSATALFP
AGGATGEHLVSLLNDEKVAVETVYARDWTRQNLHVHVESSGEQYRFVMPGATITDDEFRQ
LEEKVLAIESGAILVISGSLPPGVSVEKLQQLIKAARAQGIRLIVDSSGDALAAALEVGD
IELVKPNQKELAALVKRDLTAPDDVRKAAEELVQQGKARRVVVSLGPQGALGVDGKDCVQ
VVPPPMKSQSTVGAGDSMVGAMTLRLSQDAPLLDMVRYGVAAGSAATINQGTRLCSLENT
ESIYHWLTR
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggtacgtatttatacgctcacgctggcgccctcgctcgacagcgccacaatcacgccg
caaatctatccggaagggaaactacgctgcagcgcgccggtttttgaacccggcggcggc
ggtattaacgtcgcacgcgccatcgtccatctgggcggcagcgccacggccctcttcccg
gcgggtggcgcgacgggcgagcatctggtctcgctgcttaatgatgaaaaggtcgcggtc
gagacggtttacgcccgcgactggactcgccagaatcttcacgtgcatgtcgaatcgagc
ggcgagcaataccgcttcgttatgccaggcgccacgattaccgacgatgaattccgccag
ctggaagaaaaagtgctggcgattgaatcgggcgcaatcctggtcatcagcggcagcctg
ccgcccggtgtaagcgtggagaaactccagcaactgattaaagcggcacgtgcgcaaggg
attcgcctgattgtcgacagctccggtgacgcgctggccgccgcgctggaagttggcgat
atcgaactggttaaacccaatcagaaagagctggcggcgctggtgaaacgcgatctgacc
gcgccggacgatgtgcgtaaggccgcagaagaactggtacaacaagggaaagcccgccgc
gttgtggtttcactggggccgcagggcgcgctcggcgttgatggtaaagactgcgttcag
gttgtgccgccgccgatgaaaagccagagtaccgtcggtgcgggcgacagcatggtcggc
gccatgacgctgcgcttatcccaggatgccccgctgctggatatggtgcgttatggtgtc
gcagctggcagcgccgctactatcaatcagggtacgcgcctctgctcgctggagaatacc
gagagtatttaccactggctgacacgctaa

DBGET integrated database retrieval system