KEGG   Cronobacter sakazakii ES15: ES15_2285Help
Entry
ES15_2285         CDS       T02119                                 

Gene name
pfk2
Definition
(GenBank) 6-phosphofructokinase 2
  KO
K16370  6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
csk  Cronobacter sakazakii ES15
Pathway
csk00010  Glycolysis / Gluconeogenesis
csk00030  Pentose phosphate pathway
csk00051  Fructose and mannose metabolism
csk00052  Galactose metabolism
csk00680  Methane metabolism
csk01100  Metabolic pathways
csk01110  Biosynthesis of secondary metabolites
csk01120  Microbial metabolism in diverse environments
csk01130  Biosynthesis of antibiotics
csk01200  Carbon metabolism
csk01230  Biosynthesis of amino acids
Module
csk_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:csk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ES15_2285 (pfk2)
   00030 Pentose phosphate pathway
    ES15_2285 (pfk2)
   00051 Fructose and mannose metabolism
    ES15_2285 (pfk2)
   00052 Galactose metabolism
    ES15_2285 (pfk2)
  Energy metabolism
   00680 Methane metabolism
    ES15_2285 (pfk2)
Enzymes [BR:csk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     ES15_2285 (pfk2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin Carb_kinase DUF2617
Motif
Other DBs
NCBI-ProteinID: AFJ99858
Position
2447951..2448880
Genome map
AA seq 309 aa AA seqDB search
MVRIYTLTLAPSLDSATITPQIYPEGKLRCSAPVFEPGGGGINVARAIVHLGGSATALFP
AGGATGEHLVSLLNDEKVAVETVYARDWTRQNLHVHVESSGEQYRFVMPGATITDDEFRQ
LEEKVLAIESGAILVISGSLPPGVSVEKLQQLIKAARAQGIRLIVDSSGDALAAALEVGD
IELVKPNQKELAALVKRDLTAPDDVRKAAEELVQQGKARRVVVSLGPQGALGVDGKDCVQ
VVPPPMKSQSTVGAGDSMVGAMTLRLSQDAPLLDMVRYGVAAGSAATINQGTRLCSLENT
ESIYHWLTR
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggtacgtatttatacgctcacgctggcgccctcgctcgacagcgccacaatcacgccg
caaatctatccggaagggaaactacgctgcagcgcgccggtttttgaacccggcggcggc
ggtattaacgtcgcacgcgccatcgtccatctgggcggcagcgccacggccctcttcccg
gcgggtggcgcgacgggcgagcatctggtctcgctgcttaatgatgaaaaggtcgcggtc
gagacggtttacgcccgcgactggactcgccagaatcttcacgtgcatgtcgaatcgagc
ggcgagcaataccgcttcgttatgccaggcgccacgattaccgacgatgaattccgccag
ctggaagaaaaagtgctggcgattgaatcgggcgcaatcctggtcatcagcggcagcctg
ccgcccggtgtaagcgtggagaaactccagcaactgattaaagcggcacgtgcgcaaggg
attcgcctgattgtcgacagctccggtgacgcgctggccgccgcgctggaagttggcgat
atcgaactggttaaacccaatcagaaagagctggcggcgctggtgaaacgcgatctgacc
gcgccggacgatgtgcgtaaggccgcagaagaactggtacaacaagggaaagcccgccgc
gttgtggtttcactggggccgcagggcgcgctcggcgttgatggtaaagactgcgttcag
gttgtgccgccgccgatgaaaagccagagtaccgtcggtgcgggcgacagcatggtcggc
gccatgacgctgcgcttatcccaggatgccccgctgctggatatggtgcgttatggtgtc
gcagctggcagcgccgctactatcaatcagggtacgcgcctctgctcgctggagaatacc
gagagtatttaccactggctgacacgctaa

DBGET integrated database retrieval system