KEGG   Cronobacter sakazakii ES15: ES15_2316Help
Entry
ES15_2316         CDS       T02119                                 

Gene name
pncA
Definition
nicotinamidase/pyrazinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
csk  Cronobacter sakazakii ES15
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:csk00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2478355..2478996
Genome map
AA seq 213 aa AA seqDB search
MNSRALLLVDLQNDFCAGGALAVAEGDSTVDIANAMIEWCQSRGEPVVASQDWHPANHGS
FASVQHAEPFTQGTLDGLPQTWWPDHCIQESDGAALHPLLNQKAIEQRFYKGENPAIDSY
SAFFDNGHRQKTALDAWLREHGVSELIVMGLATDYCVKYTVLDALSLGYTVNVITDGCRG
VNLTPQASMLAFQEMAASGATLYTLDDWRETQA
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgaactcacgcgccctgctgctggtggatctgcaaaacgatttttgcgccggcggcgcg
ctggcggtcgcggaaggcgacagcacggtggatatcgcgaacgcgatgattgaatggtgt
cagagccgcggcgagccggtggtggcaagccaggactggcacccggcgaatcacggcagc
tttgcttctgttcagcacgccgagccgttcacgcaaggcacgctcgacggcctgccgcaa
acctggtggcccgatcactgcattcaggagagcgacggcgcggcgctccatccgctcctg
aaccagaaggccattgagcagcgcttttacaaaggcgaaaacccggcgattgacagctac
agcgcgtttttcgataacgggcaccgccagaaaaccgcgcttgacgcctggcttcgcgag
catggcgtaagcgagttgatcgtcatgggacttgccaccgactactgcgtcaaatacacg
gtgcttgatgcgctaagcctggggtatacggtgaacgtgattaccgacggctgccgcggc
gttaacctgacgccgcaggccagtatgctggcgtttcaggagatggcggcgagtggcgcc
acgctctatacgcttgacgactggcgcgaaacgcaggcataa

DBGET integrated database retrieval system