KEGG   Cronobacter sakazakii ES15: ES15_2641Help
Entry
ES15_2641         CDS       T02119                                 

Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
csk  Cronobacter sakazakii ES15
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:csk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ES15_2641
Enzymes [BR:csk01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     ES15_2641
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2834816..2836207
Genome map
AA seq 463 aa AA seqDB search
MTIFPDNFLWGGAIAANQAEGAWNADGKGPSIADVVRGGIASGKHDATIDPALYYASHEA
IDFYHRYKEDVALFAEMGFKCFRTSIAWSRIFPRGDEQTPNEAGLAFYDALFDELLKYGI
EPVITLSHYETPLALFEEYGGWQNRALIDFFTRYCETVFRRYQHKVKYWMTFNELNNMNR
MPFATGAVEAGASPQAIYQANHHQFVANALANKLCHEIIPQAKIGCMLSLSTVYPATCNP
DDVFATYQLRRRSLFYADVMMRGHYPAYATRLFRDNDIHLDIHPGDTELLAQYPSDYLGF
SYYRSVLHKAGAKLRVDTGGAMGEDNPYLEKTAWGWPIDPVGLRLVCNELADRYEKPLFI
VENGYGGEDIADENGEFNDEARIQYGCQHIQEMAEAVADGCDIMGYTWWGPIDIVSAGTG
EMKKRYGFIYVDKDNEGNGTLARRRKRSFTWYQQVIASNGERL
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgacgattttcccggataactttttatggggcggcgcgattgccgccaatcaggccgaa
ggcgcgtggaatgcggacggcaaagggccgtccatcgccgacgtggtgcgcggcggcatc
gcctccggcaaacacgacgcgaccattgacccggcgctttattacgcgagccacgaggcc
atcgatttttatcatcgctacaaagaggatgtggcgctgttcgccgaaatgggctttaaa
tgctttcgcacgtcgattgcctggtcgcgcatcttcccacgcggcgatgagcagacgccg
aacgaggcgggcctcgccttttacgacgccctgttcgacgagctgctgaaatatggcatt
gaaccggtcattacgctttcccactacgaaacgccgctggcgctgtttgaggaatacggc
ggctggcagaaccgcgcgcttatcgatttcttcacccgctactgcgagacggtgtttcgc
cgctatcagcataaggtcaaatactggatgacctttaacgagctgaacaacatgaaccgg
atgccgttcgccaccggcgcggtggaggcaggcgcgtcgccgcaggcgatttaccaggcc
aatcatcaccagtttgtcgccaacgccctcgccaataagctgtgccatgagattatcccg
caggcgaaaatcggctgcatgttgtcgttaagcacggtctacccggccacctgcaacccg
gatgacgtgttcgccacgtatcagttgcgccgccgttcgctgttttacgccgacgtgatg
atgcgcgggcattatccggcctacgcaacgcggctgtttcgcgataacgacattcatctg
gatattcaccccggcgataccgaactgctggcgcaatatccttcggattatctcggcttt
agctattaccgcagcgtgctgcataaagcgggcgcaaagcttcgcgtggacaccggcggc
gcgatgggcgaggacaatccgtaccttgagaaaaccgcctggggctggcctatcgatccg
gtcgggctgcggctggtgtgtaacgagctggccgaccgctacgagaaaccgctgtttatc
gtggaaaacggctacggcggtgaggatatcgccgatgaaaatggcgagtttaacgacgag
gcgcgcattcagtatggctgccagcatattcaggagatggccgaagccgtggcggacggc
tgcgacatcatgggatacacctggtgggggccgattgatatcgtcagcgccggcaccggc
gagatgaaaaagcgctacgggtttatttatgtcgataaagacaacgagggcaacggcacc
ctcgcgcggcgcaggaagcgcagcttcacgtggtatcagcaggtgatcgcaagcaacggc
gagcggctttag

DBGET integrated database retrieval system