KEGG   Cronobacter sakazakii ES15: ES15_2669Help
Entry
ES15_2669         CDS       T02119                                 

Definition
pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
csk  Cronobacter sakazakii ES15
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csk00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ES15_2669
   00500 Starch and sucrose metabolism
    ES15_2669
Enzymes [BR:csk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     ES15_2669
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2862862..2864172
Genome map
AA seq 436 aa AA seqDB search
MNTFSVSRLALAFAFGVTLTACSSTPPDQRPSEQRAPGTSARPVLSADEAKNFVPARYFA
NIDPNAAPWAPSPIRLPEKADFVVGQAGEQGVTHTSIQAAVDAAIARHATARQYIAVLPG
TYEGTVYVPAAPGSVTIYGTGEKPLDVKISAALDSEMDANTWRRTVNPSGKYMPGKPAWY
MFDNCQNRRNGSVGLMCSAVFWSQNNGLQLQNLTIENSLGDAAGEGQHQAVALRTDGDRV
QINKVNVLGRQNPFLVTNSDIRNRFTPDRLTRTQVTNSYVEGDVDLVAGRGAVVFDNTEF
RVVNTRTQKEGYVFAPATMPNFYYGFLAVNSRFVAAGEGVAQLGRAWDMDASANGYTPGQ
TPNGQVVIRDSVIDAGFNTAQPWGPALGSQRPFTGNTGAQDDKGNIQRDLNDANANRLWE
YNNRGLGSKVVAEPKK
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
ttgaacacattttcggtttcccgtctggcgctggcgttcgcttttggcgtgacactgact
gcatgcagctcaacgccaccggaccaacgtccttctgaacaacgcgcgccgggtacgtcg
gctcgcccggtgctgtctgcggatgaagcgaaaaatttcgtcccggcccgctatttcgcc
aatatcgatccgaatgccgcgccgtgggcgccctccccgattcgactgcctgaaaaagca
gacttcgtggtcggccaggcgggcgaacagggcgtgactcacaccagcattcaggccgcc
gttgatgccgcgattgcgcgtcacgcgacggcgcgtcagtacatcgctgtactccccggc
acttacgaaggcaccgtttatgtgccagccgcaccgggcagcgtcacaatttacggcacc
ggcgaaaaaccgctggatgtgaaaatcagcgccgcgctggacagcgaaatggatgccaat
acctggcgtcgtaccgtgaacccgtccggcaaatatatgcctggcaaaccggcctggtat
atgttcgacaactgccagaaccgccgcaacggcagcgtcggcctgatgtgctccgcggtg
ttctggtcgcaaaataatggcctgcaactgcaaaacctgaccattgaaaacagcctcggc
gacgccgcgggcgaaggtcagcaccaggctgtcgcgctgcgcaccgacggcgaccgcgtg
cagatcaacaaagtgaatgttctgggccgccagaatccgttcctggtaaccaacagcgat
attcgcaaccgcttcacgccggatcgtctgacccgcacgcaggtgacgaacagctacgtg
gaaggtgatgtggatctggtcgcgggccgcggcgcggtggtgtttgataacaccgaattc
cgcgtagtgaacacccgtacccagaaagaaggttatgtgtttgcgccagcgaccatgccg
aacttctattacggcttcctcgccgttaacagccgctttgtcgcggccggtgaaggcgtg
gcgcagcttggccgcgcatgggatatggacgcgagcgccaacggttataccccaggccag
acgccaaacggtcaggttgttatccgcgacagcgtgattgacgccggcttcaacaccgcg
cagccgtggggcccggcgctgggctcacagcgtccgttcaccggcaacaccggcgcgcag
gacgacaaaggcaatatccagcgcgatctgaacgacgcgaacgccaaccgtctgtgggaa
tacaacaaccgcgggctgggcagcaaagtggttgccgaaccgaaaaagtaa

DBGET integrated database retrieval system