KEGG   Cronobacter sakazakii ES15: ES15_2681Help
Entry
ES15_2681         CDS       T02119                                 

Gene name
gpmA
Definition
(RefSeq) phosphoglyceromutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
csk  Cronobacter sakazakii ES15
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:csk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ES15_2681 (gpmA)
   01230 Biosynthesis of amino acids
    ES15_2681 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ES15_2681 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    ES15_2681 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ES15_2681 (gpmA)
Enzymes [BR:csk01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     ES15_2681 (gpmA)
Exosome [BR:csk04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   ES15_2681 (gpmA)
  Exosomal proteins of melanoma cells
   ES15_2681 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2876298..2877050
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNNENRFTGWYDVDLSEKGVSEAKAAGKLLKDEGYSFDFAYTSVL
KRAIHTLWNILDGLDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFA
VTPPALTKDDERFPGHDPRYAKLSEQELPLTESLALTIDRVIPYWNETILPRLKSGERVI
IAAHGNSLRALVKYLDNMSEEEILELNIPTGVPLVYEFDENFKPIKHYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgttactaagctggttctggttcgtcacggcgaaagccagtggaacaacgaaaac
cgctttaccggttggtacgacgttgacctgtctgagaaaggcgtcagcgaagcgaaagcc
gcgggcaagctgctgaaagacgaaggctacagctttgactttgcttatacctccgtgctg
aaacgtgccatccacacgctgtggaacatcctggacgggctggatcaggcctggctgccg
gttgaaaaatcctggaaactgaacgagcgtcactacggcgccctgcagggtctgaacaaa
gctgaaaccgctgaaaaatacggtgacgagcaggtgaaacagtggcgtcgcggcttcgcg
gtgactccgccggcgctgaccaaagatgacgagcgtttcccgggtcacgatccgcgttac
gcgaaactgagcgagcaggagctgccgctgactgagagcctggcgctgaccatcgatcgc
gttatcccttactggaacgaaaccattctgccgcgcctgaaaagcggtgagcgcgtaatt
atcgccgctcacggtaactccctgcgcgcgctggtgaaatacctggataacatgagcgaa
gaagagatccttgagctgaacatcccgaccggcgtgccgctggtgtatgagttcgacgaa
aacttcaaaccgattaagcactactatctgggcaacgctgacgagatcgcagcgaaagcg
gcggctgtcgcaaaccagggtaaagcgaagtaa

DBGET integrated database retrieval system