KEGG   Cronobacter sakazakii ES15: ES15_2737Help
Entry
ES15_2737         CDS       T02119                                 

Definition
chitobiase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
csk  Cronobacter sakazakii ES15
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:csk00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:csk00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2939254..2941683)
Genome map
AA seq 809 aa AA seqDB search
MTDKNWTIWFHSIRQILNVDNDQFKVTHVMGDLHKLEPTDKFTGFPAKSSVEIPIINEYW
QLFITDVLPRWYVTADDGAPKVITSTDTETLTDFVSPLNDQWKRTPDDKNILMTAEARFD
KNSDVRTLNAERLRGQIVPTPRHVKVHGQNVSLEKGVQLDIAALEKPAQEAIFARFALLG
IKTDAGYPVRTAIASHAFSGKEAVSGAYQLHIGQKETTITGYDRAGVFYGLQSLLSLIPA
EGAKQIATLDALDAPRFDYRGIQLDVGRNFHTKVAVLRLLDQMAAYKLNKFHFHLSDDEG
WRIEIPGLPELTDVGAKRCHDLSEKTCLLPQLGSGPDTNNNGSGYFTRADYIEIVKYAAA
RQIEVIPEVDMPAHARAAVIAMEARYDRLQKAGKTEEANQYRLLDPKDTSVTTGVQYYNR
TGYLNPCLDSSRRFVDKVIGEIQQMHKEAGQPLTTWHFGGDEAKNIYLGAGYTDKAKPEA
GKGIIDQSRQDKPWARSPVCQKMVQDGVVADVEHLSSYFGVEVSKLVKAHGIDTMQAWQD
GLKDAKDASAFATSHVNVNFWDTLYWGGFDTANDWANKGFRVVVSNPDYVYLDFPNEVNP
AESGYYWGTRFSDERKIFSFAPDNLPQNAETSVDRDGNAFSAKSDKPWPGAYGLSAQLWS
EVVRTDKQMEYMMYPRLLAVAERAWHRAAWEQDYQAGREYKGGETHQVDVKALHDDWTRF
ANLAGSRELPKLEKAGVQFRLSVPGARIHDGVLQMNVSLPGVAIEYSTDGGAHWQRYDDA
KPPRVTGAVQVRSVSSDGKRYSRVDNVQP
NT seq 2430 nt NT seq  +upstreamnt  +downstreamnt
gtgacggacaaaaactggactatctggtttcacagcattcgccagatcctcaatgttgat
aacgatcagtttaaagtgacccatgtgatgggcgatctccacaagcttgaaccgacggat
aaattcaccggcttcccggcgaaatcgtcggtggagatcccgattatcaatgaatactgg
caactctttatcaccgacgtgctgccgcgctggtatgtcacggcggatgacggcgcgccg
aaggttatcaccagtaccgataccgaaacgctgacggattttgtcagcccgctgaacgat
cagtggaagcgcacgccggatgataaaaatatcctgatgaccgccgaagcgcgattcgac
aaaaacagcgatgtcagaacgctgaacgcagagcgcctgcgcgggcagatcgtgcccacg
ccgcggcacgtcaaagtacacgggcaaaatgtttctctcgaaaaaggcgttcagctcgat
attgccgcgctggagaaacccgcacaggaggcgattttcgcccgtttcgcgctgctcggt
ataaaaactgatgcaggctacccggtacgcacagccattgccagccacgcctttagtggt
aaagaggcggtatccggcgcatatcaactgcatattggccaaaaagagacgacgattacc
ggctatgaccgcgcgggcgtcttttacgggctgcaatcgctgctgtcgctgatcccggct
gagggcgcgaagcaaatcgccacgctcgatgcgctggacgcgccgcgttttgattatcgc
ggcattcaactcgatgtgggacgcaacttccacactaaagtcgctgtgcttcgcctgctt
gaccagatggcggcctataagctcaataaattccactttcatttgagcgatgacgaaggc
tggcgtattgaaataccgggcttgccggaactgaccgatgtaggggcgaagcgctgtcac
gatctcagcgaaaaaacctgcctgctgccgcagctcggctccgggccagatacgaacaac
aacggcagcggctacttcacccgcgcggattatatcgagattgtgaaatatgccgccgcg
cgccagatagaagtgatcccggaagtcgacatgcccgcacatgcccgcgcggcggtgatt
gcgatggaagcgcgctacgacaggctgcagaaagcgggtaaaaccgaagaggcgaaccag
tatcgcctgctcgacccgaaagatacgtccgtcaccactggcgtgcagtactacaaccgc
accggctatctcaatccgtgcctcgactcctcgcgccgctttgtcgataaagtgattggt
gagatccagcagatgcacaaagaggccggacagccgctcaccacctggcattttggcggc
gatgaggcgaaaaatatctatctcggcgcgggttatacggataaagcgaaaccggaggcc
gggaaggggattatcgaccagagccgtcaggacaagccctgggcgcgctcgccagtgtgt
cagaaaatggtgcaggacggtgtcgtcgctgatgtcgagcacctctccagctattttggc
gtggaagtaagcaaactggtcaaagcgcatggcatcgacactatgcaggcgtggcaggac
gggcttaaggatgcgaaagacgccagcgcgttcgccacctcgcacgttaacgtcaacttc
tgggacacgctctactggggcggtttcgatacagcgaacgactgggcgaataaaggtttc
cgcgtggtggtttctaaccccgattacgtctacctcgatttcccgaatgaagtgaatccg
gcggagagcggctattactggggcacacgctttagcgacgaacgtaagattttcagcttc
gcgccggataacctcccgcaaaacgccgagacatccgtcgatcgcgacggcaacgcgttc
agcgctaagtcggacaaaccctggccaggcgcgtacggtctctcggcgcagctctggagc
gaagtggtgcgcaccgataaacaaatggagtacatgatgtacccgcgtctgttagctgta
gctgaacgcgcctggcatcgcgcggcctgggagcaggattatcaggctggtcgcgaatat
aaaggcggcgaaacccatcaggtggatgtaaaagcgctgcatgatgactggacgcgcttt
gcgaacctggcgggcagccgtgagctgccgaagcttgaaaaagcgggcgtgcaattccgc
ctgtcggtgccgggcgcgcggattcacgacggcgtgttgcagatgaacgtcagtctgcca
ggggttgcgatagaatactcgactgatggcggcgcgcactggcagcgctatgatgatgcg
aagccaccacgcgtgacgggggccgtacaggtacgaagcgtcagcagcgacggtaaacgt
tacagccgcgtggataacgtacagccctaa

DBGET integrated database retrieval system