KEGG   Cronobacter sakazakii ES15: ES15_2796Help
Entry
ES15_2796         CDS       T02119                                 

Gene name
mtnD
Definition
acireductone dioxygenase
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
csk  Cronobacter sakazakii ES15
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:csk00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3006796..3007338
Genome map
AA seq 180 aa AA seqDB search
MSALTIFADNGASEPLWQSTDADAIREQLNAQGVRFERWQADRDLGDNPTPEAVLTAYQH
AIDQLVAEKGYQGWDVISMRADNPQKEALRGKFLNEHTHGEDEVRFFVEGAGLFCLHIGD
KVYQVLCEKNDLISVPAGTPHWFDMGSQPHFTAIRIFDNPEGWIANFTGSPIAEAYPRLA
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcactgacgatttttgccgataacggtgccagcgaaccgctgtggcagagcacc
gacgccgacgctatccgcgaacagcttaacgcgcagggcgtgcgtttcgaacgctggcag
gccgaccgcgatctcggcgataacccgacgccggaggcggtgttgaccgcctatcagcac
gcgattgaccagctggtggcggaaaaaggctaccagggctgggatgtgatcagcatgcgc
gccgataacccgcagaaagaggcgctacgcggcaagtttctcaatgagcatacccacggc
gaagatgaagtgcggtttttcgtggaaggcgccgggttgttctgtctgcacatcggcgac
aaggtgtatcaggtgttgtgcgagaagaatgatttgatttcggtgcccgccggcacaccg
cactggtttgatatgggctcgcagccgcatttcacggcgatccgcattttcgataacccg
gaaggctggattgcgaatttcaccggcagcccgatagccgaagcgtacccgcgtctggcg
tag

DBGET integrated database retrieval system