KEGG   Cronobacter sakazakii ES15: ES15_2862Help
Entry
ES15_2862         CDS       T02119                                 

Gene name
tesA
Definition
multifunctional acyl-CoA thioesterase I/protease I/lysophospholipase L1
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
csk  Cronobacter sakazakii ES15
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:csk01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3078823..3079452
Genome map
AA seq 209 aa AA seqDB search
MMNFKNVFRWHFPFLLLALLSFRAAAADTLLVLGDSLSAGYRMAADAAWPALLNDKWQQR
DVRVVNASISGDTAQQGLSRLPALLKQHQPRWVLIELGGNDGLRGFPPDTLSATLRKIIE
QVKTAGAEPLLMQIRLPANYGRRYNQAFEAIYPELAQSFSIPLLPFFMEEVYLKPQWMQD
DGIHPNRDAQPFIADWMAQRLAPLVKHDS
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgatgaacttcaagaatgttttccgctggcatttccctttcctgttactggcgttatta
agctttcgcgccgccgcggcggacacgttactggtgctgggcgacagcctgagcgccggt
tatcgtatggcggcggacgccgcctggcctgcgctgctgaacgataaatggcagcagcgc
gacgtgcgcgtggtcaacgcgagcatcagcggcgacaccgctcagcaggggctctcgcgc
ctgcctgcgctgcttaaacagcatcagccgcgctgggtgttgattgagcttggcgggaat
gacggcctgcgcggttttccgccggatacactttccgccacgctcaggaaaatcatagaa
caggttaaaaccgcgggcgcggagccgctgctgatgcagatccgcctgccagcgaactac
ggacgccgctacaatcaggcgtttgaagcgatttacccggaactggcgcaatctttttcc
atccccctgctgcccttttttatggaagaggtttacctcaaaccgcagtggatgcaggac
gatggcattcatcccaatcgcgacgcccagccgtttattgccgactggatggcgcagcga
ctggcccctttagttaaacacgactcataa

DBGET integrated database retrieval system