KEGG   Cronobacter sakazakii ES15: ES15_2884Help
Entry
ES15_2884         CDS       T02119                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
csk  Cronobacter sakazakii ES15
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:csk00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    ES15_2884 (recR)
DNA repair and recombination proteins [BR:csk03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      ES15_2884 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3104687..3105292)
Genome map
AA seq 201 aa AA seqDB search
MQTSPLLTQLMEALRCLPGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADC
RTFTEQEKCNICTNPRRQENGQICVVESPADIHAIEQTGQFSGRYFVLMGHLSPLDGIGP
DDIGLDRLEQRLAAEPLKEIILATNPTVEGEATANYIAELCAQYGVDASRIAHGVPVGGE
LEMVDGTTLSHSLAGRHKMTF
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcagaccagtcctctgctgactcaactgatggaagcgttgcgctgcctgccgggcgtg
ggcccgaaatcggcgcagcgcatggcgtttacgctgctgcaacgcgatcgcagcggcggg
atgcggcttgctcaggcgctgacccgcgccatgtcggagataggccactgcgccgactgc
cgcaccttcaccgagcaggaaaaatgtaatatctgcaccaatccgcgccgtcaggaaaac
ggacagatttgcgtagtggaaagcccggcggatatccacgccatcgagcagaccggccag
ttctcgggccgttatttcgtactgatgggccatctttcgccgctcgacggtatcggcccg
gacgatatcgggcttgatcgcctggaacagcgcctcgccgccgagccgttaaaagagatt
attctcgcgaccaacccgacggtggaaggcgaggcgaccgccaattacatcgccgagctt
tgcgcccagtatggcgttgacgcaagccgtatcgcgcacggcgtgccggtgggcggcgag
ctcgaaatggtcgacggcaccacgctttcgcactcgcttgccgggcggcataaaatgacg
ttttaa

DBGET integrated database retrieval system