KEGG   Cronobacter sakazakii ES15: ES15_3016Help
Entry
ES15_3016         CDS       T02119                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
csk  Cronobacter sakazakii ES15
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:csk00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ES15_3016 (hemB)
Enzymes [BR:csk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     ES15_3016 (hemB)
Exosome [BR:csk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ES15_3016 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3250493..3251470
Genome map
AA seq 325 aa AA seqDB search
MADFSLSSRPRRLRQNASLRAMFEETSLSRNDLVLPIFVEEELDDYKPIAAMPGVMRIPE
RYLAREIERIAKAGIRSVMTFGISHHTDECGSDTWNENGLVARMSRIAKDAVPEMVVMSD
TCFCEYTSHGHCGVLCEHGVDNDATLVNLGRQAVVAAAAGADFIAPSAAMDGQVKAIRQA
LDAAGFTDTAIFSYSTKFASSFYGPFREAAGTALKGDRKTYQMSPMNRREAIRESLLDEA
EGADALMVKPAGAYLDILRDVRERTSLPLGAYQVSGEYAMIKFAAQAGAIDEEKVILESL
GAIKRAGADLIFSYFALDLAEKNIL
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggccgatttttcattgagttcccgcccgcgccgcctgcgtcagaacgcctcgctgcgc
gccatgtttgaagaaacctcgttaagccgcaacgatttggtactgccgattttcgttgag
gaagagctggacgactacaaaccgatcgccgccatgccgggcgtgatgcgtatcccggag
agatatctcgcccgtgaaattgagcgtattgcgaaagcgggcatccgctccgtgatgacc
ttcgggatttcgcaccacaccgatgagtgcggcagcgacacctggaatgaaaacggtctg
gtggcgcgtatgtcgcgtatcgccaaagacgccgtgccggaaatggtcgtgatgtctgac
acctgcttttgcgaatataccagccacggccactgcggcgtgctgtgcgagcatggcgtg
gacaacgacgcgaccctggtaaacctgggccgtcaggctgtggttgctgccgctgcgggt
gccgattttatcgcaccttccgccgcgatggacggccaggtgaaagccatccgtcaggcg
ctcgacgccgcgggcttcacggatacggcgattttctcctactccaccaaattcgcgtcg
tcgttctacggcccgttccgcgaagcagcgggcaccgcgctgaaaggcgatcgtaaaact
tatcagatgagcccgatgaaccgccgcgaagcaatccgcgaatcgctgctggatgaagcc
gaaggcgcggacgcgctgatggtcaaaccggcgggcgcttatctcgacatcctgcgcgat
gtgcgcgagcgcaccagcctgccgcttggcgcttatcaggtgagcggcgaatacgcgatg
atcaaattcgccgcccaggcgggcgcgattgacgaagagaaagtgatcctggaaagcctc
ggcgctatcaagcgcgcgggcgcggatcttatcttcagctacttcgcactcgatctggcc
gagaaaaacattctctga

DBGET integrated database retrieval system