KEGG   Cronobacter sakazakii ES15: ES15_3158Help
Entry
ES15_3158         CDS       T02119                                 

Gene name
dxr
Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
csk  Cronobacter sakazakii ES15
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:csk00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3404733..3405962)
Genome map
AA seq 409 aa AA seqDB search
MRLFLFHVERLMKHLTILGSTGSIGCSTLDVIRHNPEEFSVTALVAGKNVARMVEQCLEF
RPRFAVMDDEASARELRETLRQHGSRTEVLAGRDAACEMAALDDVTQVMAAIVGAAGLLP
TLAAIAAGKQVLLANKESLVTCGRLFMDAVAQSGAQLLPVDSEHNAIFQSLPATIQHNLG
YAKLEESGVSSIILTGSGGPFRQTPLPELAAMTPDQACRHPNWSMGRKISVDSATMMNKG
LEYIEARWLFNARADQMEVLIHPQSVIHSMVRYADGSVLAQLGEPDMRTPIAHTMAWPAR
VPSGVQHLDFCKIATLSFGEPDYQRYPCLKLAMDAFEKGQAATTALNAANEITVAAFLAG
EIRFTDIAALNQAVLDEMDLREPQSVDEVLTVDAEARVVAQKRVTRLAS
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttattcttatttcacgttgagcgcctcatgaagcatttaaccattctcggctca
accggctctatcggttgcagcacccttgatgttattcgccataatccggaagaattttcg
gtgaccgccctggtggcgggaaagaatgtcgccagaatggttgagcaatgcctggagttt
cgcccccgtttcgcggtaatggatgatgaggcgagcgcccgtgaattgcgtgaaacgctg
cgccagcacggcagccgcactgaagtattagccgggcgcgacgccgcctgcgagatggcg
gcgctcgacgatgtgacccaggtgatggcggccattgtcggtgccgccgggcttctgccg
acgcttgcggctatcgccgccggtaagcaagtgttactggcgaataaagaatcgctggtg
acctgcgggcgactttttatggacgcggtcgcgcagagcggggcgcaactgctgccggtg
gacagcgagcacaacgcgatttttcagagtttaccggcaacaattcaacacaacctgggg
tacgctaaacttgaggaaagcggagtttcttcgattatcctcaccggatctggtggaccg
tttcgacagacgcctttgcctgaactggccgcaatgacgccggaccaggcgtgccgtcat
cctaactggtcgatggggcgtaaaatatccgtcgattcggctaccatgatgaataaaggt
ctcgaatacattgaagctcgctggctgtttaacgcccgggcagaccagatggaagtattg
attcatccacagtcggtgattcattccatggtgcgttatgccgatggcagcgtgctggca
caactgggcgaacccgatatgcgcacccccatcgcgcatacgatggcctggccggcgcgc
gtcccttccggcgtgcagcatctggatttttgcaagatagcgacgctgagcttcggtgaa
ccggattatcagcgttatccgtgtctgaagctcgccatggatgccttcgaaaaagggcag
gcggcgacaacagcgctgaatgcggcgaatgaaattacggttgctgcttttcttgccgga
gagattcgttttacggatatcgcagcgcttaatcaggcggtgctggatgaaatggatctt
cgcgaaccgcaaagtgtggatgaagtgctcacagtcgacgccgaagcgcgtgttgttgcg
cagaaacgggtgacgcgtctcgcaagctga

DBGET integrated database retrieval system