KEGG   Cronobacter sakazakii ES15: ES15_3237Help
Entry
ES15_3237         CDS       T02119                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
csk  Cronobacter sakazakii ES15
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:csk00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    ES15_3237
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ES15_3237
Enzymes [BR:csk01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     ES15_3237
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3498500..3499915)
Genome map
AA seq 471 aa AA seqDB search
MTLDSRVAAAGDLFVAVVGHQADGRRYIPQAIAQGVAAIVAEAKGEATDGEVREIHGVPV
IYLSQLNERLSALAGRFYDEPSERLRLIGVTGTNGKTTTTQLIAQWCQRLGETSAVMGTV
GNGLLGKVMPTENTTGSAVDVQHVLSGLAAQGATVAAMEVSSHGLVQHRVAALKFAATVF
TNLSRDHLDYHGDMEHYEAAKWLLFSAHHYGQAVINADDEVGRRWLAKLPDAVAVSMENN
INPGCHGRWLRADAVEYHDRGATLRFSSSWGDGEIESRLMGAFNVSNLLLALGTLLALGY
PLAALLESAPRLQPVNGRMEVFSALGKPTVVVDYAHTPDALEKALQAARLHCAGKLWCVF
GCGGDRDKGKRPLMGAIAEQFADVVVVTDDNPRTEDPKAIIADILTGMLDAGRARVVEGR
AEAVTNAIMQAAENDVVLLAGKGHEDYQIVGTRRLDYSDRVTAARLLGAVA
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgaccctggacagccgcgtggcggcggcgggggatctctttgtggcggtggtcggtcat
caggcggacgggcgtcggtatatcccgcaggcgatagcgcaaggtgtagctgccatcgtc
gccgaagcgaaaggcgaggcgacggacggcgaagtccgtgagatccacggcgtgccggtt
atctatttaagccagttgaacgagcgtctctcggcgctggcggggcgtttttatgatgag
ccatccgagcgtctgcgcctgattggcgtgacgggcaccaacggtaaaaccaccaccacg
cagcttatcgcgcagtggtgccagcggctgggcgaaaccagcgccgtgatgggcacggta
ggcaacgggttacttggcaaagtgatgccgacggaaaacaccaccggctctgcggtggat
gttcagcatgtgctgtcaggtcttgcggcacagggcgcgaccgtggccgcgatggaagtc
tcttcccacggtctggtgcaacatcgcgtggcggcactgaaattcgccgccacggtattt
accaatttaagccgcgatcatctcgactatcacggcgatatggaacattacgaagcggcg
aaatggctgctgttctccgcgcaccattacgggcaggcggtgatcaacgccgatgatgaa
gtgggccgccggtggctggcgaagctcccggacgccgtcgcggtgtcgatggaaaacaac
attaatccgggctgtcacggccgctggctgcgcgcggatgcggtggaatatcacgaccgc
ggcgcgacgctgcgctttagctcctcctggggcgatggcgaaatcgaaagccgcctgatg
ggcgcgtttaacgtcagcaacctgttgctggcgctcggcacgctgctggcgctcggttac
ccgctcgccgcgctgctcgaaagcgcgccgcgcctccagccggttaacgggcgcatggaa
gtgttcagcgcgctgggcaaaccgaccgtggtggtcgattacgcgcacacgccggacgcg
ctcgaaaaagcgctgcaggccgcgcgtctgcactgtgcgggcaagctgtggtgcgtattc
ggttgcggcggcgatcgcgataaaggcaaacgcccgctgatgggcgcgattgccgagcaa
ttcgccgatgtcgtggtggtcactgatgataacccgcgcaccgaagatccgaaggcgatc
atcgcggatatcctgaccggcatgctggatgcgggccgcgcgcgggtcgttgaaggccgc
gccgaagccgtgaccaacgccattatgcaggcggcggaaaacgacgtcgtgctgctggcg
ggtaaaggccacgaggattatcagattgtcggcacccgccgacttgattattccgatcgc
gtcactgcggcgcgtctgctgggagcagtggcatga

DBGET integrated database retrieval system