KEGG   Cronobacter sakazakii ES15: ES15_3272Help
Entry
ES15_3272         CDS       T02119                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
csk  Cronobacter sakazakii ES15
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:csk00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:csk00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3541560..3542039)
Genome map
AA seq 159 aa AA seqDB search
MISLIAALAVDRVIGMENAMPWDLPADLAWFKRNTLNKPVIMGRLTWESIGRPLPGRKNI
VLSSRPGDDDRVVWVRSVEEALQACGDAEEVMVIGGGRVYEQFLPRAQRLYLTHIDAEVE
GDTHFPDYEPDEWQSVFSEFHDADEKNSHSYCFEILERR
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgatcagtctgattgcggctttagcggtggatcgcgtgattggtatggaaaacgccatg
ccgtgggacctccctgccgatctcgcctggtttaaacgtaacacgcttaacaaaccggtt
atcatggggcgtctgacctgggagtcgatcggtcgcccgctgccgggccggaaaaatatc
gtgctcagcagccgtccgggcgacgatgaccgtgtggtgtgggtgcgctccgttgaggaa
gcgttacaggcctgcggcgatgccgaagaagtgatggtgattggcggcggtcgcgtttac
gaacagttcctgccgcgtgcgcagcgtctttatctcacccatatcgatgcggaagtggaa
ggcgatacccatttcccggattacgagccggacgagtggcagtcggtgttcagcgaattc
catgacgccgatgagaagaactcacacagctattgtttcgagattcttgagcgccgttaa

DBGET integrated database retrieval system