KEGG   Cronobacter sakazakii ES15: ES15_3345Help
Entry
ES15_3345         CDS       T02119                                 

Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
csk  Cronobacter sakazakii ES15
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:csk00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3628713..3630035)
Genome map
AA seq 440 aa AA seqDB search
MFLAQEIIRKKRDGHALSDEEIRFFINGIRDNTVSEGQIAALAMTIFFHDMTMPERVSLT
MAMRDSGTVLDWKSLNLNGPVVDKHSTGGVGDVTSLMLGPMVAACGGYIPMISGRGLGHT
GGTLDKLEAIPGFDIFPDDNRFRDIIKNVGVAIIGQTNSLAPADKRFYATRDITATVDSI
PLITASILAKKLAEGLDALVMDVKVGSGAFMPTYALSEELAQAIVGVANGAGVRTTALLT
DMNEVLASSAGNAVEVREAVRFLTGDYRNPRLLEVTMALCVEMLLSGGLAKDETEARAKL
QQVLDNGQAAEIFGRMVAAQSGPADFVDNYERYLPAATLRKAVYADRSGFVTQMDTRALG
MAVVAMGGGRRQASDSIDYSVGLTDMARLGEQVDGERPLAIIHAKSEASWQEAAAAVKAA
INVDDTAAKTSPVVYRRISE
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
gtgttcctcgctcaagaaattattcgtaaaaagcgcgacggccatgcgctcagcgacgaa
gagatccgcttttttattaacggcattcgcgataacactgtgtccgaaggccagatcgcc
gcgctggcgatgacgattttctttcacgacatgaccatgccggagcgagtctcgctgacg
atggcgatgcgcgattccggcaccgtgctggactggaaaagcctgaacctcaacggcccg
gtcgtggataaacactccaccggcggcgtgggcgacgtgacctcgctgatgctgggcccg
atggtcgcggcgtgcggcggttacattccgatgatttccgggcgcgggctgggccacacc
ggcggcaccctcgataaactggaagcgatcccggggtttgatattttcccggacgacaat
cgctttcgcgacattattaaaaacgtgggcgtggcgataattggccagaccaactcgctg
gcgccggcggataaacgcttctatgcgacgcgtgatatcaccgcgaccgtcgattctatt
ccgctgatcactgcctcgatcctcgcgaaaaaactcgccgaagggctggacgcgctggtg
atggacgtgaaagtgggcagcggggcatttatgccgacttatgcgctctctgaagagctg
gcgcaggcgatcgttggcgtggcgaacggtgcgggcgtgcgcacgaccgcactgctgacc
gacatgaatgaagtgctggcctccagcgccggtaacgcggtggaagtccgtgaggcggtg
cggttcctgaccggcgattaccgcaacccgcgcctgctggaagtgacgatggcgctgtgc
gtcgagatgctgctctccggggggcttgcgaaagacgagactgaggcgcgcgcgaagctg
caacaggtgctggacaacggccaggcggcggagattttcgggcgtatggtggcggcgcaa
agcggcccggcggattttgtcgacaactacgagcgctacctgcccgcggccacgctccgc
aaagcagtttatgccgaccgttccggctttgttacgcaaatggatacccgcgcgctcggt
atggcggtcgtcgccatgggcggcggtcgccgtcaggcgtccgacagcattgattacagc
gtcggcctgaccgatatggcgcgcctcggcgagcaggttgacggcgagcgtccgctggcc
atcatccacgcgaagagcgaagcgagctggcaggaagcggcggcggccgttaaagcggcc
atcaacgttgacgatacggcggcgaaaacgtcaccggttgtctatcgcagaatcagcgaa
taa

DBGET integrated database retrieval system