KEGG   Cronobacter sakazakii ES15: ES15_3439Help
Entry
ES15_3439         CDS       T02119                                 

Definition
aspartate carbamoyltransferase catalytic subunit
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
csk  Cronobacter sakazakii ES15
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:csk00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    ES15_3439
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ES15_3439
Enzymes [BR:csk01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     ES15_3439
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3731659..3732594
Genome map
AA seq 311 aa AA seqDB search
MANPLYQKHIISINDLSRAELELVLETAAKLKANPQPELLKHKVIASCFFEASTRTRLSF
ETSMHRLGAAVVGFSDSSNTSLGKKGETLADTISVISTYVDAIVMRHPQEGAARLATEFS
GGVPVLNAGDGANQHPTQTLLDLFTIQETQGRLENLTIAMVGDLKYGRTVHSLAQALAKF
NGNRFCFIAPDALAMPQYILDMLDEKGIPWSLHSAIEDVVQEVDILYMTRVQKERLDPSE
YANVKAQFVLRAADLQGARANMKVLHPLPRIDEITTDVDKTPHAWYFQQAGNGIFARQAL
LALVLNRDLAL
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggctaatccgctttatcaaaaacatattatttccatcaacgatctcagccgcgccgag
ttagagctggtgctggagacggcggcgaagctgaaagcgaacccgcagccggagctgctg
aagcacaaagtgatcgccagctgcttttttgaagcctcgacccgcacccgcctgtcgttt
gaaacctccatgcaccgcctcggcgcggcggtggtcggcttctccgacagcagcaatacc
tcgcttggcaaaaaaggcgaaacgctggcggataccatttcggttatcagcacctatgtg
gacgccattgtgatgcgccatccgcaggaaggcgcggcgcgtctggcgaccgagttttcc
ggcggcgtgccggtgctgaacgcgggcgacggcgccaaccagcacccgacgcaaacgctg
ctggatctctttaccatccaggagacccaggggcgtcttgagaacctcaccatcgcgatg
gtcggcgacctgaaatatggccgcacggtgcattcgctggcgcaggcgctggcgaaattc
aacggcaaccgcttctgctttatcgccccggacgcgctggcgatgccgcagtacatcctc
gatatgctggatgagaaaggcattccgtggagcctgcacagcgccattgaagacgtggtg
caggaggtggacattctctatatgacccgcgtacagaaagagcgtctcgacccgtcggaa
tacgccaacgtgaaggcccagtttgtgctgcgcgccgccgatttgcagggcgcgcgcgcg
aatatgaaagtgctgcacccgctgccgcgcattgatgagatcacaaccgatgtggataaa
acgccgcacgcctggtatttccagcaggcgggcaacggcattttcgcccgtcaggcgctg
ctggcgctggtactgaatcgcgatttagcgctgtaa

DBGET integrated database retrieval system